Scaffold Ga0136212_1000049

Overview

Basic Information

• Taxon OID: 3300010218
• Scaffold ID: Ga0136212_1000049
• Source Dataset Name: Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week1, replicate 1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Fidelity Systems Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 64966
• Total Scaffold Genes: 74
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 56 (75.68%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location

• Location Name: Bangor area, North Wales, UK
• Coordinates
  • Lat. (^o): 53.24
  • Long. (^o): -4.01

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096514	Metagenome / Metatranscriptome	104	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136212_100004921	F096514	AGGAG	MDLIDLYHRRGIALVRSKLRGSAAARRGYGRLARLYSEQIERQRALLPDAPELTPAL*