3300010218: Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week1, replicate 1

Overview

Basic Information

• IMG/M Taxon OID: 3300010218
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121424 | Gp0154106 | Ga0136212
• Sample Name: Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week1, replicate 1
• Sequencing Status: Permanent Draft
• Sequencing Center: Fidelity Systems Inc
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 87759337
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil
• Type: Engineered
• Taxonomy: Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Bangor area, North Wales, UK
• Coordinates
  • Lat. (^o): 53.24
  • Long. (^o): -4.01
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080973	Metagenome	114	Y
F096514	Metagenome / Metatranscriptome	104	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136212_1000049	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	64966
Ga0136212_1001274	Not Available	9157

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136212_1000049	Ga0136212_100004921	F096514	MDLIDLYHRRGIALVRSKLRGSAAARRGYGRLARLYSEQIERQRALLPDAPELTPAL*
Ga0136212_1001274	Ga0136212_10012743	F080973	MTLQTAIPTQGDVREMIAGAIGELTGTPKGEVDLGASRVLVLGDTRSGYNWSYPDAMVKARFRPFVHRAVSMVRQQYPILR*