| Basic Information | |
|---|---|
| Taxon OID | 3300010050 Open in IMG/M |
| Scaffold ID | Ga0133945_100004 Open in IMG/M |
| Source Dataset Name | Microbial community associated with xenic strain of Nostoc sp. EX-5-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Oregon State University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1221605 |
| Total Scaffold Genes | 1178 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 873 (74.11%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain → Microbial Community Associated With Xenic Strain Of Nostoc Sp. Ex-5-1 |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | unknown | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F062002 | Metagenome / Metatranscriptome | 131 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0133945_100004412 | F062002 | GAGG | MSAQEFHRATKRGAVDARPGAALILGGILLLTRP* |
| ⦗Top⦘ |