NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133945_100004

Scaffold Ga0133945_100004


Overview

Basic Information
Taxon OID3300010050 Open in IMG/M
Scaffold IDGa0133945_100004 Open in IMG/M
Source Dataset NameMicrobial community associated with xenic strain of Nostoc sp. EX-5-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOregon State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1221605
Total Scaffold Genes1178 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)873 (74.11%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain → Microbial Community Associated With Xenic Strain Of Nostoc Sp. Ex-5-1

Source Dataset Sampling Location
Location Nameunknown
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062002Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0133945_100004412F062002GAGGMSAQEFHRATKRGAVDARPGAALILGGILLLTRP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.