Scaffold Ga0133945_100004

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133945_100004

Scaffold Ga0133945_100004

Overview

Basic Information
Taxon OID	3300010050 Open in IMG/M
Scaffold ID	Ga0133945_100004 Open in IMG/M
Source Dataset Name	Microbial community associated with xenic strain of Nostoc sp. EX-5-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Oregon State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1221605
Total Scaffold Genes	1178 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	873 (74.11%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain → Microbial Community Associated With Xenic Strain Of Nostoc Sp. Ex-5-1

Source Dataset Sampling Location
Location Name	unknown
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062002	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133945_100004412	F062002	GAGG	MSAQEFHRATKRGAVDARPGAALILGGILLLTRP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.