| Basic Information | |
|---|---|
| Taxon OID | 3300009945 Open in IMG/M |
| Scaffold ID | Ga0117932_1002710 Open in IMG/M |
| Source Dataset Name | Combined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Wisconsin, Madison |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 14493 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (73.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA | |||||||
| Coordinates | Lat. (o) | 44.71538 | Long. (o) | -110.73627 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064893 | Metagenome / Metatranscriptome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0117932_100271011 | F064893 | AGGAGG | MSKIIRYEFMGSWFRFWLMCLTVIGIPFAVLYLIDGTLRMEHEIDDPERFVEAFRSGKLTKKS* |
| ⦗Top⦘ |