NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103681_1008494

Scaffold Ga0103681_1008494


Overview

Basic Information
Taxon OID3300009296 Open in IMG/M
Scaffold IDGa0103681_1008494 Open in IMG/M
Source Dataset NameMicrobial communities from groundwater in Rifle, Colorado, USA-3A_0.2um
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterLawrence Berkeley National Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6059
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (62.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater → Microbial Communities From Groundwater In Rifle, Colorado, Usa

Source Dataset Sampling Location
Location NameRifle, CO, USA
CoordinatesLat. (o)39.32Long. (o)-107.46Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F069483Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0103681_10084943F069483AGGVRLAFESPGDRDGKRVARPERIRTASEIPIEVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIARPLGINPWMAKKAARWGNIQKG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.