NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115550_1176443

Scaffold Ga0115550_1176443


Overview

Basic Information
Taxon OID3300009076 Open in IMG/M
Scaffold IDGa0115550_1176443 Open in IMG/M
Source Dataset NamePelagic marine microbial communities from North Sea - COGITO_mtgs_100511
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)731
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameGermany:Helgoland, sampling site Kabeltonne, North Sea
CoordinatesLat. (o)54.1883Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005743Metagenome / Metatranscriptome391Y
F018266Metagenome / Metatranscriptome236N
F080091Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0115550_11764431F018266GGAVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKREL
Ga0115550_11764432F080091GAGGMSLKLWKFLSVRIKVEDHNGKIHWYNETDCNAHDIGKEYEIENIINKQGGKYDEEEVGKKQDT*
Ga0115550_11764433F005743N/ANRHEDYNTQTGRFVRTKRIVMTPDEVNQTDGYWRNHRNVEKKFAKQMMGREDAYWDSKYRVMRVRKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.