NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080091

Metagenome / Metatranscriptome Family F080091

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080091
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 63 residues
Representative Sequence MSLKLWKFLSVRIKVEDHNGKIHWYDETDCEEHDLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Number of Associated Samples 102
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 87.83 %
% of genes near scaffold ends (potentially truncated) 21.74 %
% of genes from short scaffolds (< 2000 bps) 87.83 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group environmental samples (66.087 % of family members)
NCBI Taxonomy ID 186616
Taxonomy All Organisms → Viruses → environmental samples

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(26.956 % of family members)
Environment Ontology (ENVO) Unclassified
(81.739 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.783 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.87%    β-sheet: 30.16%    Coil/Unstructured: 53.97%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF01381HTH_3 1.74
PF00149Metallophos 0.87
PF03237Terminase_6N 0.87



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.39 %
UnclassifiedrootN/A2.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10194214All Organisms → Viruses → environmental samples → uncultured marine virus688Open in IMG/M
3300000115|DelMOSum2011_c10206659All Organisms → Viruses → environmental samples → uncultured marine virus544Open in IMG/M
3300000116|DelMOSpr2010_c10139164All Organisms → Viruses → environmental samples → uncultured marine virus847Open in IMG/M
3300000117|DelMOWin2010_c10078458All Organisms → Viruses → Predicted Viral1296Open in IMG/M
3300000256|LP_F_10_SI03_120DRAFT_1014680All Organisms → Viruses → Predicted Viral2011Open in IMG/M
3300001450|JGI24006J15134_10094404All Organisms → Viruses → environmental samples → uncultured marine virus1087Open in IMG/M
3300001460|JGI24003J15210_10046984All Organisms → Viruses → Predicted Viral1460Open in IMG/M
3300001589|JGI24005J15628_10109479All Organisms → Viruses → environmental samples → uncultured marine virus910Open in IMG/M
3300004448|Ga0065861_1095588All Organisms → Viruses → environmental samples → uncultured marine virus1262Open in IMG/M
3300004831|Ga0069134_167096All Organisms → Viruses → environmental samples → uncultured marine virus627Open in IMG/M
3300005078|Ga0070770_10143913All Organisms → Viruses → environmental samples → uncultured marine virus681Open in IMG/M
3300006382|Ga0075494_1364569All Organisms → Viruses → environmental samples → uncultured marine virus583Open in IMG/M
3300006399|Ga0075495_1096352All Organisms → Viruses → environmental samples → uncultured marine virus538Open in IMG/M
3300006399|Ga0075495_1096976All Organisms → Viruses → environmental samples → uncultured marine virus550Open in IMG/M
3300006735|Ga0098038_1116273All Organisms → Viruses → environmental samples → uncultured marine virus912Open in IMG/M
3300006735|Ga0098038_1164759All Organisms → Viruses → environmental samples → uncultured marine virus732Open in IMG/M
3300006737|Ga0098037_1077544All Organisms → Viruses → Predicted Viral1169Open in IMG/M
3300006737|Ga0098037_1101128All Organisms → Viruses → environmental samples → uncultured marine virus998Open in IMG/M
3300006752|Ga0098048_1034021All Organisms → Viruses → Predicted Viral1650Open in IMG/M
3300006752|Ga0098048_1140484All Organisms → Viruses → environmental samples → uncultured marine virus722Open in IMG/M
3300006789|Ga0098054_1022276Not Available2515Open in IMG/M
3300006789|Ga0098054_1342965All Organisms → Viruses → environmental samples → uncultured marine virus531Open in IMG/M
3300006793|Ga0098055_1240530All Organisms → Viruses → environmental samples → uncultured marine virus682Open in IMG/M
3300006802|Ga0070749_10147520All Organisms → Viruses → Predicted Viral1369Open in IMG/M
3300006803|Ga0075467_10250206All Organisms → Viruses → environmental samples → uncultured marine virus962Open in IMG/M
3300006916|Ga0070750_10495027All Organisms → Viruses → environmental samples → uncultured marine virus501Open in IMG/M
3300006921|Ga0098060_1131563All Organisms → Viruses → environmental samples → uncultured marine virus699Open in IMG/M
3300006922|Ga0098045_1041513All Organisms → Viruses → environmental samples → uncultured marine virus1158Open in IMG/M
3300006924|Ga0098051_1043194All Organisms → Viruses → Predicted Viral1257Open in IMG/M
3300006925|Ga0098050_1185873All Organisms → Viruses → environmental samples → uncultured marine virus519Open in IMG/M
3300006990|Ga0098046_1028559All Organisms → Viruses → environmental samples → uncultured marine virus1373Open in IMG/M
3300007344|Ga0070745_1013421All Organisms → Viruses → environmental samples → uncultured marine virus3798Open in IMG/M
3300007539|Ga0099849_1128518All Organisms → Viruses → environmental samples → uncultured marine virus993Open in IMG/M
3300007862|Ga0105737_1112166All Organisms → Viruses → environmental samples → uncultured marine virus694Open in IMG/M
3300007963|Ga0110931_1232639All Organisms → Viruses → environmental samples → uncultured marine virus548Open in IMG/M
3300009074|Ga0115549_1089328All Organisms → Viruses → Predicted Viral1041Open in IMG/M
3300009076|Ga0115550_1176443All Organisms → Viruses → environmental samples → uncultured marine virus731Open in IMG/M
3300009420|Ga0114994_10464436All Organisms → Viruses → environmental samples → uncultured marine virus835Open in IMG/M
3300009437|Ga0115556_1143233All Organisms → Viruses → environmental samples → uncultured marine virus885Open in IMG/M
3300009476|Ga0115555_1030210All Organisms → Viruses → Predicted Viral2593Open in IMG/M
3300009543|Ga0115099_10943691All Organisms → Viruses → environmental samples → uncultured marine virus921Open in IMG/M
3300009593|Ga0115011_11402024All Organisms → Viruses → environmental samples → uncultured marine virus612Open in IMG/M
3300009608|Ga0115100_10078459All Organisms → Viruses → environmental samples → uncultured marine virus520Open in IMG/M
3300009677|Ga0115104_11174529All Organisms → Viruses → environmental samples → uncultured marine virus712Open in IMG/M
3300011013|Ga0114934_10050633All Organisms → Viruses → Predicted Viral2141Open in IMG/M
3300012953|Ga0163179_10196851All Organisms → Viruses → Predicted Viral1540Open in IMG/M
3300017708|Ga0181369_1064946All Organisms → Viruses → environmental samples → uncultured marine virus796Open in IMG/M
3300017709|Ga0181387_1071839All Organisms → Viruses → environmental samples → uncultured marine virus697Open in IMG/M
3300017710|Ga0181403_1029341All Organisms → Viruses → environmental samples → uncultured marine virus1162Open in IMG/M
3300017710|Ga0181403_1096909All Organisms → Viruses → environmental samples → uncultured marine virus616Open in IMG/M
3300017713|Ga0181391_1042272All Organisms → Viruses → Predicted Viral1090Open in IMG/M
3300017713|Ga0181391_1125018All Organisms → Viruses → environmental samples → uncultured marine virus575Open in IMG/M
3300017714|Ga0181412_1017822All Organisms → Viruses → Predicted Viral2024Open in IMG/M
3300017714|Ga0181412_1124032All Organisms → Viruses → environmental samples → uncultured marine virus594Open in IMG/M
3300017719|Ga0181390_1045401All Organisms → Viruses → Predicted Viral1309Open in IMG/M
3300017719|Ga0181390_1100106All Organisms → Viruses → environmental samples → uncultured marine virus777Open in IMG/M
3300017725|Ga0181398_1044777All Organisms → Viruses → environmental samples → uncultured marine virus1075Open in IMG/M
3300017727|Ga0181401_1180100All Organisms → Viruses → environmental samples → uncultured marine virus504Open in IMG/M
3300017728|Ga0181419_1151620All Organisms → Viruses → environmental samples → uncultured marine virus554Open in IMG/M
3300017729|Ga0181396_1038208All Organisms → Viruses → environmental samples → uncultured marine virus954Open in IMG/M
3300017731|Ga0181416_1166598All Organisms → Viruses → environmental samples → uncultured marine virus532Open in IMG/M
3300017734|Ga0187222_1012029All Organisms → Viruses → Predicted Viral2130Open in IMG/M
3300017737|Ga0187218_1042702All Organisms → Viruses → Predicted Viral1142Open in IMG/M
3300017739|Ga0181433_1137579All Organisms → Viruses → environmental samples → uncultured marine virus579Open in IMG/M
3300017742|Ga0181399_1048953All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300017743|Ga0181402_1097132All Organisms → Viruses → environmental samples → uncultured marine virus763Open in IMG/M
3300017743|Ga0181402_1155261All Organisms → Viruses → environmental samples → uncultured marine virus578Open in IMG/M
3300017744|Ga0181397_1178568All Organisms → Viruses → environmental samples → uncultured marine virus536Open in IMG/M
3300017746|Ga0181389_1123935All Organisms → Viruses → environmental samples → uncultured marine virus699Open in IMG/M
3300017755|Ga0181411_1202878All Organisms → Viruses → environmental samples → uncultured marine virus556Open in IMG/M
3300017757|Ga0181420_1028139All Organisms → Viruses → environmental samples → uncultured marine virus1851Open in IMG/M
3300017763|Ga0181410_1031131All Organisms → Viruses → Predicted Viral1709Open in IMG/M
3300017765|Ga0181413_1266721All Organisms → Viruses → environmental samples → uncultured marine virus503Open in IMG/M
3300017769|Ga0187221_1041040All Organisms → Viruses → Predicted Viral1521Open in IMG/M
3300017769|Ga0187221_1061115All Organisms → Viruses → Predicted Viral1193Open in IMG/M
3300017772|Ga0181430_1152590All Organisms → Viruses → environmental samples → uncultured marine virus670Open in IMG/M
3300017786|Ga0181424_10087920All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300017950|Ga0181607_10045608All Organisms → Viruses → Predicted Viral3015Open in IMG/M
3300018036|Ga0181600_10555788All Organisms → Viruses → environmental samples → uncultured marine virus539Open in IMG/M
3300018041|Ga0181601_10204688All Organisms → Viruses → Predicted Viral1156Open in IMG/M
3300018048|Ga0181606_10098641All Organisms → Viruses → Predicted Viral1844Open in IMG/M
3300019751|Ga0194029_1001206All Organisms → Viruses → Predicted Viral3272Open in IMG/M
3300020266|Ga0211519_1020934All Organisms → Viruses → Predicted Viral1504Open in IMG/M
3300020379|Ga0211652_10122149All Organisms → Viruses → environmental samples → uncultured marine virus789Open in IMG/M
3300020438|Ga0211576_10161790All Organisms → Viruses → Predicted Viral1207Open in IMG/M
3300020469|Ga0211577_10366858All Organisms → Viruses → environmental samples → uncultured marine virus897Open in IMG/M
3300021347|Ga0213862_10153796All Organisms → Viruses → environmental samples → uncultured marine virus809Open in IMG/M
3300021378|Ga0213861_10356118All Organisms → Viruses → environmental samples → uncultured marine virus733Open in IMG/M
3300021957|Ga0222717_10430028All Organisms → Viruses → environmental samples → uncultured marine virus724Open in IMG/M
3300021959|Ga0222716_10089454All Organisms → Viruses → Predicted Viral2099Open in IMG/M
3300022072|Ga0196889_1031914All Organisms → Viruses → environmental samples → uncultured marine virus1064Open in IMG/M
3300022074|Ga0224906_1109741All Organisms → Viruses → environmental samples → uncultured marine virus807Open in IMG/M
3300022164|Ga0212022_1006403All Organisms → Viruses → Predicted Viral1560Open in IMG/M
3300022178|Ga0196887_1129698All Organisms → Viruses → environmental samples → uncultured marine virus533Open in IMG/M
3300022187|Ga0196899_1053974All Organisms → Viruses → Predicted Viral1306Open in IMG/M
(restricted) 3300023210|Ga0233412_10460501All Organisms → Viruses → environmental samples → uncultured marine virus573Open in IMG/M
3300025070|Ga0208667_1023194All Organisms → Viruses → environmental samples → uncultured marine virus1181Open in IMG/M
3300025071|Ga0207896_1037577All Organisms → Viruses → environmental samples → uncultured marine virus813Open in IMG/M
3300025084|Ga0208298_1021715All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300025098|Ga0208434_1076691All Organisms → Viruses → environmental samples → uncultured marine virus686Open in IMG/M
3300025099|Ga0208669_1000846Not Available11857Open in IMG/M
3300025099|Ga0208669_1131962All Organisms → Viruses → environmental samples → uncultured marine virus500Open in IMG/M
3300025108|Ga0208793_1009540All Organisms → Viruses → Predicted Viral3911Open in IMG/M
3300025120|Ga0209535_1073718All Organisms → Viruses → Predicted Viral1326Open in IMG/M
3300025133|Ga0208299_1090009All Organisms → Viruses → environmental samples → uncultured marine virus1058Open in IMG/M
3300025168|Ga0209337_1076915All Organisms → Viruses → Predicted Viral1630Open in IMG/M
3300025508|Ga0208148_1005116All Organisms → Viruses → Predicted Viral4320Open in IMG/M
3300025674|Ga0208162_1085286All Organisms → Viruses → environmental samples → uncultured marine virus968Open in IMG/M
3300028125|Ga0256368_1028886All Organisms → Viruses → environmental samples → uncultured marine virus990Open in IMG/M
3300028137|Ga0256412_1326438All Organisms → Viruses → environmental samples → uncultured marine virus564Open in IMG/M
3300028600|Ga0265303_10443516All Organisms → Viruses → environmental samples → uncultured marine virus1037Open in IMG/M
3300029448|Ga0183755_1000883Not Available17561Open in IMG/M
3300029448|Ga0183755_1050891All Organisms → Viruses → Predicted Viral1042Open in IMG/M
3300032047|Ga0315330_10336049All Organisms → Viruses → environmental samples → uncultured marine virus945Open in IMG/M
3300033742|Ga0314858_171132All Organisms → Viruses → environmental samples → uncultured marine virus558Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine26.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater26.96%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.17%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.83%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh3.48%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.48%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.48%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.61%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.74%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.87%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.87%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.87%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Surface SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater0.87%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.87%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.87%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.87%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000256Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004831Marine surface microbial communities from the North Atlantic Ocean - filtered matterEnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007862Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2umEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009074Pelagic marine microbial communities from North Sea - COGITO_mtgs_100430EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017725Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017729Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018041Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041407BS metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020266Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX556082-ERR598951)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1019421423300000101MarineMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIXNKQGGTFDEEEVGKKQDT*
DelMOSum2011_1020665933300000115MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKK
DelMOSpr2010_1013916413300000116MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKK
DelMOWin2010_1007845843300000117MarineMNLKLWKLLSVRIKVEDNNGKIHWYDESDCDEHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT*
LP_F_10_SI03_120DRAFT_101468073300000256MarineMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT*
JGI24006J15134_1009440413300001450MarineESEKSMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIXXXIEDIINKQGGTFDEEEVGKXQDT*
JGI24003J15210_1004698433300001460MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIIKTQGGTFDEEEVGKKQDT*
JGI24005J15628_1010947923300001589MarineMSLKLWKFXSVRIKVEDHNGXIHWYDETDCNXHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT*
Ga0065861_109558833300004448MarineMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEVGKENSEIRNT*
Ga0069134_16709623300004831Surface SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT*
Ga0070770_1014391323300005078WaterMSLKLWKLLSIRIKIEDHNGKIHWYDETDCEEHNLGIEYDITDIIKHQGGTLDEEEVGKNKEDI*
Ga0075494_136456913300006382AqueousMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEVKKKQDT*
Ga0075495_109635223300006399AqueousKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEVGKKQDT*
Ga0075495_109697623300006399AqueousKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT*
Ga0098038_111627323300006735MarineMSLKLWKLLNIRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT*
Ga0098038_116475923300006735MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT*
Ga0098037_107754423300006737MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCELHNLGIEYDIEDIINKQGGTFDEEEVGKTKNT*
Ga0098037_110112823300006737MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCKAHNLGIEYDIEDIINKQGGTFDEDEVGKENK*
Ga0098048_103402133300006752MarineMSLKLWKLLNIRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDKEEVGKTKDT*
Ga0098048_114048423300006752MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKKQNT*
Ga0098054_102227693300006789MarineMTLKLWKLLSVKIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGK
Ga0098054_134296513300006789MarineMTLKLWKLLSVRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKKQNT*
Ga0098055_124053023300006793MarineMTLKLWKLLSVRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT*
Ga0070749_1014752043300006802AqueousMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT*
Ga0075467_1025020633300006803AqueousMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT*
Ga0070750_1049502723300006916AqueousMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEVGKKQDT*
Ga0098060_113156323300006921MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCKAHNLGIEYDIEDIINKQGGTFDEDEVGKTKDT*
Ga0098045_104151323300006922MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT*
Ga0098051_104319443300006924MarineMTLKLWKLLSVRIKVEDHNGKIHWYDETDCETHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT*
Ga0098050_118587313300006925MarineMSLKLWKLLNIRIKVEDHNGKIHWYDETDCETHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT*
Ga0098046_102855953300006990MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKNT*
Ga0070745_101342123300007344AqueousMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKNQDT*
Ga0099849_112851813300007539AqueousMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIAIEWDIEDIINKQGGTFDEEEVGKKQDT*
Ga0105737_111216623300007862Estuary WaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNKHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT*
Ga0110931_123263923300007963MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT*
Ga0115549_108932833300009074Pelagic MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYDIEDIINKQGGTFDEEEVGKKQDT*
Ga0115550_117644323300009076Pelagic MarineMSLKLWKFLSVRIKVEDHNGKIHWYNETDCNAHDIGKEYEIENIINKQGGKYDEEEVGKKQDT*
Ga0114994_1046443633300009420MarineMEYKKSMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT*
Ga0115556_114323323300009437Pelagic MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESYCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT*
Ga0115555_103021023300009476Pelagic MarineMSLKLWKLLSIRIKIEDHNGKIHWYDETDCEEHNLGIEYDIEDIINKQGGTFDKEEVGKKQDT*
Ga0115099_1094369133300009543MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEEHNLGIEYDVEDIINKQGGTFDEEEVGKKQDT*
Ga0115011_1140202423300009593MarineMSLKLWKLLSIRIKVEDHNGKIHWYDETDCDEHDLGIECDITDIIKHQGGTLDEEEVGKNKEDI*
Ga0115100_1007845923300009608MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEEHNLGIEYDVEDIINKQGGTFDEEEVGKTKDT*
Ga0115104_1117452923300009677MarineVSEESMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT*
Ga0114934_1005063333300011013Deep SubsurfaceMSLKLWKLLSIRIKVEDHNGKIHWYDETDCDEHGLGIEYDITDIIKHQGGTLDEEEVGKKQDT*
Ga0163179_1019685133300012953SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT*
Ga0181369_106494623300017708MarineMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDKEEVGKTKDT
Ga0181387_107183923300017709SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181403_102934143300017710SeawaterMSLKLWKFLNVRIKVEDNNGKIHWYDETDCKEHNLGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181403_109690913300017710SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDKEEVGKK
Ga0181391_104227233300017713SeawaterMNLRLWKFLSVRIKVEDHNGKIHWYDETDCNAHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181391_112501833300017713SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKT
Ga0181412_101782243300017714SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKTKNT
Ga0181412_112403233300017714SeawaterMNLKLWKFLSVRIKVEDHNGKIHWYDETDCNEHDIGIEWDIEDIINKQGGTFEEEEVG
Ga0181390_104540123300017719SeawaterMNLRLWKFLSVRIKVEDHNGKIHWYDETDCNAHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0181390_110010633300017719SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT
Ga0181398_104477733300017725SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0181401_118010023300017727SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEKEVGKTKDT
Ga0181419_115162023300017728SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKNT
Ga0181396_103820833300017729SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNAHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0181416_116659823300017731SeawaterMSLKLWKLLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT
Ga0187222_101202973300017734SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0187218_104270223300017737SeawaterMNLRLWKFLSVRIKVEDHNGKIHWYDETDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181433_113757923300017739SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGSTFDEEEVGKKQDT
Ga0181399_104895323300017742SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIDDIINKQGGTFDEEEVGKTKDT
Ga0181402_109713233300017743SeawaterSEESMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIKYDIEDIINEQGGTFDKEEVGKTKDT
Ga0181402_115526133300017743SeawaterMNLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181397_117856833300017744SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNKHDIGIEWDIEDIINKQGGTFDEEEVGK
Ga0181389_112393533300017746SeawaterMSLKLWKLLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0181411_120287823300017755SeawaterMRLKLWKLLSIRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0181420_102813913300017757SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIKYDIEDIINEQGGTFD
Ga0181410_103113163300017763SeawaterMSLKLWKLLSVRIKVKDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0181413_126672123300017765SeawaterMNLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIINKQGGTFDKEEVGKKQDT
Ga0187221_104104013300017769SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0187221_106111513300017769SeawaterMNLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT
Ga0181430_115259033300017772SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDKEEVGKTKDT
Ga0181424_1008792043300017786SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEKVGKKQDT
Ga0181607_1004560883300017950Salt MarshMSLKLWKLLSIRIKIEDHNGKIHWYDETDCDEHNLGIEYDIEDIINKQGGTFDKEEVGKNKEDI
Ga0181600_1055578813300018036Salt MarshSIRIKVEDHNGKIHWYDETDCDEHNLGIEYDIEDIINKQGGTFDKEEVGKNKEDI
Ga0181601_1020468823300018041Salt MarshMSLKLWKLLSIRIKVEDHNGKIHWYDETDCDEHNLGIEYDIEDIINKQGGTFDKEEVGKNKEDI
Ga0181606_1009864133300018048Salt MarshMSLKLWKLLSIRIKIEDHNGKIHWYDETDCDEHGLGLEYDITDIIKHQGGTLHEEEVGKNKEDI
Ga0194029_100120613300019751FreshwaterMNLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0211519_102093443300020266MarineMSLKLWKFLSVRIKVEDHNGKIHWYDETDCEEHGLGIEYDITDIIKHQGGTLDEEEVGKNKEDI
Ga0211652_1012214923300020379MarineMSLKLWKLLNIRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT
Ga0211576_1016179033300020438MarineMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNKHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0211577_1036685833300020469MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0213862_1015379633300021347SeawaterMSLKLWKLLSIRIKVEDHNGKIHWYDETDCDEHGLGIEYDITDIIKHQGGTLDEEEVGKNKEDI
Ga0213861_1035611813300021378SeawaterMSLKLWKFLSVRIKVEDHNGKIHWYDESDCDEHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0222717_1043002823300021957Estuarine WaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCEEHDLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0222716_1008945443300021959Estuarine WaterMSLKLWKFLSVRIKVEDHNGKIHWYDETDCEKHDLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0196889_103191413300022072AqueousKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT
Ga0224906_110974123300022074SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGK
Ga0212022_100640343300022164AqueousMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT
Ga0196887_112969813300022178AqueousLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEIGKENSEIRNT
Ga0196899_105397423300022187AqueousMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIGIEWDIEDIINKQGGTFDEEEVGKKQNT
(restricted) Ga0233412_1046050123300023210SeawaterMNLKLWKFLSVRIKVEDHNGKIHWYDETDCEEHDLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0208667_102319423300025070MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKNT
Ga0207896_103757743300025071MarineMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNEHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT
Ga0208298_102171533300025084MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0208434_107669113300025098MarineWKLLNIRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINEQGGTFDEEEVGKTKDT
Ga0208669_1000846373300025099MarineSEESMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0208669_113196223300025099MarineMTLKLWKLLSVRIKVEDHNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKKQNT
Ga0208793_100954013300025108MarineSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEEEVGKTKDT
Ga0209535_107371823300025120MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEWDIEDIIKTQGGTFDEEEVGKKQDT
Ga0208299_109000923300025133MarineMTLKLWKLLSVRIKVEDNNGKIHWYDETDCESHNLGIEYDIEDIINKQGGTFDEDKVGKENK
Ga0209337_107691563300025168MarineMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT
Ga0208148_1005116153300025508AqueousKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0208162_108528633300025674AqueousMSLKLWKFLSVRIKVEDHNGKIHWYDESDCNEHDIAIEWDIEDIINKQGGTFDEEEVGKKQDT
Ga0256368_102888643300028125Sea-Ice BrineMILKKWKLLGIRIKVEDHNGNTYFYDESDCEEHGLGLEYDIEEIINKQGGTFDEKEIRKKHSEIRNT
Ga0256412_132643813300028137SeawaterMSLKLWKLLSVRIKVEDNNGKIHWYDETDCEAHNLGIEYDIEDIINKQGGTFDEEEVGKKQDT
Ga0265303_1044351643300028600SedimentMSLKLWKLLSIRIKIEDHNGKIHWYDETDCEEHNLGIEYDITDIIKHQGGTLDEEEVGKNKEDI
Ga0183755_1000883133300029448MarineMSLKLWKFLSVRIKVEDHNGKIHWYDETDCNAHDIGIEYEIEDIINKQGGTFDEEEVGKKQDT
Ga0183755_105089123300029448MarineMSLKLWKLLSIRIKVEDHNGKIHWYDETDCDEHGLGIEYDITDIIKHQGGTLDEEEVGKKQDT
Ga0315330_1033604933300032047SeawaterVRIKVEDHNGKIHWYDETDCNEHDIGIEYDIEDIINKQGGTFDEDEVGKKQDT
Ga0314858_171132_222_4133300033742Sea-Ice BrineMSLKLWKFLSVRIKVEDHNGKIHWYDNSDLIAEAVNIEDELEYVINKQGGTFDEEEVGKKQDT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.