NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F018266

Metagenome / Metatranscriptome Family F018266

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F018266
Family Type Metagenome / Metatranscriptome
Number of Sequences 236
Average Sequence Length 98 residues
Representative Sequence MFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Number of Associated Samples 187
Number of Associated Scaffolds 236

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 68.64 %
% of genes near scaffold ends (potentially truncated) 44.07 %
% of genes from short scaffolds (< 2000 bps) 91.10 %
Associated GOLD sequencing projects 160
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group environmental samples (68.220 % of family members)
NCBI Taxonomy ID 186616
Taxonomy All Organisms → Viruses → environmental samples

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(23.729 % of family members)
Environment Ontology (ENVO) Unclassified
(86.441 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.678 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.00%    β-sheet: 36.00%    Coil/Unstructured: 39.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 236 Family Scaffolds
PF01381HTH_3 7.63
PF03237Terminase_6N 0.85
PF01541GIY-YIG 0.42



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.80 %
UnclassifiedrootN/A7.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10053790All Organisms → Viruses → Predicted Viral1989Open in IMG/M
3300000101|DelMOSum2010_c10084389All Organisms → Viruses → Predicted Viral1389Open in IMG/M
3300000101|DelMOSum2010_c10203928All Organisms → Viruses → environmental samples → uncultured marine virus661Open in IMG/M
3300000115|DelMOSum2011_c10055849All Organisms → Viruses → Predicted Viral1520Open in IMG/M
3300000116|DelMOSpr2010_c10128005All Organisms → Viruses → environmental samples → uncultured marine virus905Open in IMG/M
3300000117|DelMOWin2010_c10049731All Organisms → Viruses → Predicted Viral1861Open in IMG/M
3300000117|DelMOWin2010_c10135774All Organisms → Viruses → environmental samples → uncultured marine virus834Open in IMG/M
3300000117|DelMOWin2010_c10238388All Organisms → Viruses → environmental samples → uncultured marine virus538Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1004298All Organisms → Viruses → Predicted Viral3326Open in IMG/M
3300000947|BBAY92_10099859All Organisms → Viruses → environmental samples → uncultured marine virus773Open in IMG/M
3300000949|BBAY94_10133210All Organisms → Viruses → environmental samples → uncultured marine virus677Open in IMG/M
3300001352|JGI20157J14317_10062364All Organisms → Viruses → Predicted Viral1599Open in IMG/M
3300001450|JGI24006J15134_10073780All Organisms → Viruses → environmental samples → uncultured marine virus1299Open in IMG/M
3300001450|JGI24006J15134_10094404All Organisms → Viruses → environmental samples → uncultured marine virus1087Open in IMG/M
3300001450|JGI24006J15134_10096784All Organisms → Viruses → environmental samples → uncultured marine virus1067Open in IMG/M
3300001450|JGI24006J15134_10145041All Organisms → Viruses → environmental samples → uncultured marine virus785Open in IMG/M
3300001450|JGI24006J15134_10211729All Organisms → Viruses → environmental samples → uncultured marine virus582Open in IMG/M
3300001589|JGI24005J15628_10109479All Organisms → Viruses → environmental samples → uncultured marine virus910Open in IMG/M
3300001589|JGI24005J15628_10210565All Organisms → Viruses → environmental samples → uncultured marine virus538Open in IMG/M
3300002231|KVRMV2_100026318All Organisms → Viruses10069Open in IMG/M
3300004461|Ga0066223_1105509All Organisms → Viruses → Predicted Viral1538Open in IMG/M
3300005078|Ga0070770_10143913All Organisms → Viruses → environmental samples → uncultured marine virus681Open in IMG/M
3300006027|Ga0075462_10244646All Organisms → Viruses → environmental samples → uncultured marine virus532Open in IMG/M
3300006029|Ga0075466_1020799All Organisms → Viruses → Predicted Viral2126Open in IMG/M
3300006164|Ga0075441_10071078All Organisms → Viruses → environmental samples → uncultured marine virus1355Open in IMG/M
3300006399|Ga0075495_1096352All Organisms → Viruses → environmental samples → uncultured marine virus538Open in IMG/M
3300006399|Ga0075495_1096976All Organisms → Viruses → environmental samples → uncultured marine virus550Open in IMG/M
3300006419|Ga0075496_1337758All Organisms → Viruses → environmental samples → uncultured marine virus654Open in IMG/M
3300006484|Ga0070744_10096823All Organisms → cellular organisms → Bacteria → Proteobacteria854Open in IMG/M
3300006637|Ga0075461_10203682All Organisms → cellular organisms → Bacteria → Proteobacteria592Open in IMG/M
3300006735|Ga0098038_1219795All Organisms → cellular organisms → Bacteria → Proteobacteria608Open in IMG/M
3300006737|Ga0098037_1068830Not Available1254Open in IMG/M
3300006737|Ga0098037_1088228All Organisms → cellular organisms → Bacteria → Proteobacteria1083Open in IMG/M
3300006737|Ga0098037_1153202All Organisms → Viruses → environmental samples → uncultured marine virus773Open in IMG/M
3300006737|Ga0098037_1218205All Organisms → cellular organisms → Bacteria → Proteobacteria619Open in IMG/M
3300006752|Ga0098048_1134860All Organisms → Viruses → environmental samples → uncultured marine virus739Open in IMG/M
3300006789|Ga0098054_1266781All Organisms → Viruses → environmental samples → uncultured marine virus616Open in IMG/M
3300006802|Ga0070749_10506898All Organisms → Viruses → environmental samples → uncultured marine virus657Open in IMG/M
3300006810|Ga0070754_10077812All Organisms → Viruses → Predicted Viral1679Open in IMG/M
3300006916|Ga0070750_10097307Not Available1367Open in IMG/M
3300006916|Ga0070750_10440672All Organisms → Viruses → environmental samples → uncultured marine virus539Open in IMG/M
3300006919|Ga0070746_10178232All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300006920|Ga0070748_1165401All Organisms → Viruses → environmental samples → uncultured marine virus818Open in IMG/M
3300006921|Ga0098060_1129988All Organisms → cellular organisms → Bacteria → Proteobacteria704Open in IMG/M
3300006921|Ga0098060_1226452All Organisms → Viruses → environmental samples → uncultured marine virus508Open in IMG/M
3300006922|Ga0098045_1144216All Organisms → Viruses → environmental samples → uncultured marine virus550Open in IMG/M
3300006928|Ga0098041_1011746All Organisms → Viruses → Predicted Viral2908Open in IMG/M
3300006928|Ga0098041_1107351All Organisms → cellular organisms → Bacteria → Proteobacteria901Open in IMG/M
3300006929|Ga0098036_1176439All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria651Open in IMG/M
3300006990|Ga0098046_1038627All Organisms → Viruses → Predicted Viral1145Open in IMG/M
3300007229|Ga0075468_10034960All Organisms → Viruses → Predicted Viral1774Open in IMG/M
3300007236|Ga0075463_10077885All Organisms → Viruses → Predicted Viral1069Open in IMG/M
3300007346|Ga0070753_1075991All Organisms → Viruses → Predicted Viral1337Open in IMG/M
3300007540|Ga0099847_1095954All Organisms → Viruses → environmental samples → uncultured marine virus905Open in IMG/M
3300007992|Ga0105748_10228509All Organisms → Viruses → environmental samples → uncultured marine virus778Open in IMG/M
3300008221|Ga0114916_1036304All Organisms → Viruses → Predicted Viral1482Open in IMG/M
3300009076|Ga0115550_1176443All Organisms → Viruses → environmental samples → uncultured marine virus731Open in IMG/M
3300009077|Ga0115552_1031103All Organisms → Viruses → Predicted Viral2537Open in IMG/M
3300009079|Ga0102814_10569986All Organisms → Viruses → environmental samples → uncultured marine virus619Open in IMG/M
3300009149|Ga0114918_10314373All Organisms → Viruses → environmental samples → uncultured marine virus872Open in IMG/M
3300009172|Ga0114995_10170146All Organisms → Viruses → environmental samples → uncultured marine virus1214Open in IMG/M
3300009173|Ga0114996_10461040All Organisms → Viruses → environmental samples → uncultured marine virus964Open in IMG/M
3300009422|Ga0114998_10153445All Organisms → Viruses → Predicted Viral1108Open in IMG/M
3300009425|Ga0114997_10161711All Organisms → Viruses → environmental samples → uncultured marine virus1314Open in IMG/M
3300009425|Ga0114997_10399762All Organisms → Viruses → environmental samples → uncultured marine virus743Open in IMG/M
3300009433|Ga0115545_1201563All Organisms → Viruses → environmental samples → uncultured marine virus678Open in IMG/M
3300009437|Ga0115556_1321429All Organisms → Viruses → environmental samples → uncultured marine virus545Open in IMG/M
3300009440|Ga0115561_1069190All Organisms → Viruses → Predicted Viral1518Open in IMG/M
3300009443|Ga0115557_1243296All Organisms → Viruses → environmental samples → uncultured marine virus691Open in IMG/M
3300009447|Ga0115560_1086095All Organisms → Viruses → environmental samples → uncultured marine virus1313Open in IMG/M
3300009526|Ga0115004_10173580All Organisms → Viruses → environmental samples → uncultured marine virus1297Open in IMG/M
3300009526|Ga0115004_10495889All Organisms → Viruses → environmental samples → uncultured marine virus723Open in IMG/M
3300009593|Ga0115011_10554272All Organisms → Viruses → environmental samples → uncultured marine virus920Open in IMG/M
3300009603|Ga0114911_1158519All Organisms → Viruses → environmental samples → uncultured marine virus632Open in IMG/M
3300009604|Ga0114901_1155809All Organisms → Viruses → environmental samples → uncultured marine virus683Open in IMG/M
3300009677|Ga0115104_11174529All Organisms → Viruses → environmental samples → uncultured marine virus712Open in IMG/M
3300009679|Ga0115105_10678009All Organisms → Viruses → environmental samples → uncultured marine virus5153Open in IMG/M
3300009705|Ga0115000_10449124All Organisms → Viruses → environmental samples → uncultured marine virus816Open in IMG/M
3300010150|Ga0098056_1016696All Organisms → Viruses → Predicted Viral2638Open in IMG/M
3300010150|Ga0098056_1259676All Organisms → Viruses → environmental samples → uncultured marine virus575Open in IMG/M
3300010151|Ga0098061_1010373All Organisms → Viruses4032Open in IMG/M
3300010153|Ga0098059_1166400All Organisms → Viruses → environmental samples → uncultured marine virus865Open in IMG/M
3300010368|Ga0129324_10196960All Organisms → Viruses → environmental samples → uncultured marine virus820Open in IMG/M
3300010883|Ga0133547_11432825All Organisms → Viruses → environmental samples → uncultured marine virus1301Open in IMG/M
3300011013|Ga0114934_10050633All Organisms → Viruses → Predicted Viral2141Open in IMG/M
3300012919|Ga0160422_10293303All Organisms → Viruses → environmental samples → uncultured marine virus1000Open in IMG/M
3300012953|Ga0163179_10196851All Organisms → Viruses → Predicted Viral1540Open in IMG/M
3300013010|Ga0129327_10705877All Organisms → Viruses → environmental samples → uncultured marine virus565Open in IMG/M
3300017697|Ga0180120_10083134All Organisms → Viruses → Predicted Viral1408Open in IMG/M
3300017708|Ga0181369_1056360Not Available870Open in IMG/M
3300017708|Ga0181369_1064946All Organisms → Viruses → environmental samples → uncultured marine virus796Open in IMG/M
3300017709|Ga0181387_1009098All Organisms → Viruses → environmental samples → uncultured marine virus1934Open in IMG/M
3300017709|Ga0181387_1045643All Organisms → Viruses → environmental samples → uncultured marine virus869Open in IMG/M
3300017709|Ga0181387_1071137All Organisms → Viruses → environmental samples → uncultured marine virus700Open in IMG/M
3300017710|Ga0181403_1020231All Organisms → Viruses → Predicted Viral1414Open in IMG/M
3300017713|Ga0181391_1068346All Organisms → Viruses → environmental samples → uncultured marine virus821Open in IMG/M
3300017714|Ga0181412_1091314All Organisms → Viruses → environmental samples → uncultured marine virus724Open in IMG/M
3300017717|Ga0181404_1112715All Organisms → Viruses → environmental samples → uncultured marine virus664Open in IMG/M
3300017717|Ga0181404_1146805All Organisms → Viruses → environmental samples → uncultured marine virus569Open in IMG/M
3300017719|Ga0181390_1045401All Organisms → Viruses → Predicted Viral1309Open in IMG/M
3300017719|Ga0181390_1062803All Organisms → Viruses → Predicted Viral1062Open in IMG/M
3300017720|Ga0181383_1032381Not Available1409Open in IMG/M
3300017720|Ga0181383_1040095All Organisms → Viruses → environmental samples → uncultured marine virus1259Open in IMG/M
3300017726|Ga0181381_1039832All Organisms → Viruses → environmental samples → uncultured marine virus1043Open in IMG/M
3300017726|Ga0181381_1060170All Organisms → Viruses → environmental samples → uncultured marine virus824Open in IMG/M
3300017727|Ga0181401_1065051All Organisms → Viruses → environmental samples → uncultured marine virus972Open in IMG/M
3300017730|Ga0181417_1040314Not Available1147Open in IMG/M
3300017730|Ga0181417_1139754All Organisms → Viruses → environmental samples → uncultured marine virus584Open in IMG/M
3300017731|Ga0181416_1144574All Organisms → Viruses → environmental samples → uncultured marine virus573Open in IMG/M
3300017732|Ga0181415_1157985All Organisms → Viruses → environmental samples → uncultured marine virus506Open in IMG/M
3300017733|Ga0181426_1019505Not Available1333Open in IMG/M
3300017733|Ga0181426_1095374All Organisms → Viruses → environmental samples → uncultured marine virus596Open in IMG/M
3300017735|Ga0181431_1026968All Organisms → Viruses → environmental samples → uncultured marine virus1327Open in IMG/M
3300017737|Ga0187218_1038969Not Available1203Open in IMG/M
3300017740|Ga0181418_1174555All Organisms → Viruses → environmental samples → uncultured marine virus514Open in IMG/M
3300017741|Ga0181421_1078813All Organisms → Viruses → environmental samples → uncultured marine virus862Open in IMG/M
3300017742|Ga0181399_1080679All Organisms → Viruses → environmental samples → uncultured marine virus819Open in IMG/M
3300017742|Ga0181399_1083591Not Available801Open in IMG/M
3300017743|Ga0181402_1097132All Organisms → Viruses → environmental samples → uncultured marine virus763Open in IMG/M
3300017748|Ga0181393_1040901Not Available1289Open in IMG/M
3300017748|Ga0181393_1048313All Organisms → Viruses → Predicted Viral1168Open in IMG/M
3300017748|Ga0181393_1098354All Organisms → Viruses → environmental samples → uncultured marine virus755Open in IMG/M
3300017748|Ga0181393_1125937All Organisms → Viruses → environmental samples → uncultured marine virus647Open in IMG/M
3300017749|Ga0181392_1148971All Organisms → Viruses → environmental samples → uncultured marine virus685Open in IMG/M
3300017750|Ga0181405_1138473All Organisms → Viruses → environmental samples → uncultured marine virus605Open in IMG/M
3300017751|Ga0187219_1115055All Organisms → Viruses → environmental samples → uncultured marine virus803Open in IMG/M
3300017752|Ga0181400_1071987All Organisms → Viruses → environmental samples → uncultured marine virus1042Open in IMG/M
3300017755|Ga0181411_1200098All Organisms → Viruses → environmental samples → uncultured marine virus561Open in IMG/M
3300017757|Ga0181420_1218140All Organisms → Viruses → environmental samples → uncultured marine virus549Open in IMG/M
3300017759|Ga0181414_1028734Not Available1506Open in IMG/M
3300017759|Ga0181414_1188748All Organisms → Viruses → environmental samples → uncultured marine virus534Open in IMG/M
3300017760|Ga0181408_1060139All Organisms → Viruses → environmental samples → uncultured marine virus1008Open in IMG/M
3300017760|Ga0181408_1070057All Organisms → Viruses → environmental samples → uncultured marine virus924Open in IMG/M
3300017762|Ga0181422_1135283All Organisms → Viruses → environmental samples → uncultured marine virus760Open in IMG/M
3300017763|Ga0181410_1172424All Organisms → Viruses → environmental samples → uncultured marine virus601Open in IMG/M
3300017769|Ga0187221_1050555All Organisms → Viruses → Predicted Viral1339Open in IMG/M
3300017770|Ga0187217_1202301All Organisms → Viruses → environmental samples → uncultured marine virus656Open in IMG/M
3300017772|Ga0181430_1091090Not Available913Open in IMG/M
3300017776|Ga0181394_1139085All Organisms → Viruses → environmental samples → uncultured marine virus759Open in IMG/M
3300017781|Ga0181423_1177256All Organisms → Viruses → environmental samples → uncultured marine virus814Open in IMG/M
3300017782|Ga0181380_1215472All Organisms → Viruses → environmental samples → uncultured marine virus641Open in IMG/M
3300017783|Ga0181379_1255049All Organisms → Viruses → environmental samples → uncultured marine virus604Open in IMG/M
3300017783|Ga0181379_1276341All Organisms → Viruses → environmental samples → uncultured marine virus575Open in IMG/M
3300018036|Ga0181600_10555788All Organisms → Viruses → environmental samples → uncultured marine virus539Open in IMG/M
3300019751|Ga0194029_1001206All Organisms → Viruses → Predicted Viral3272Open in IMG/M
3300020173|Ga0181602_10200705All Organisms → Viruses → environmental samples → uncultured marine virus883Open in IMG/M
3300020177|Ga0181596_10078505All Organisms → Viruses → Predicted Viral1764Open in IMG/M
3300020185|Ga0206131_10082479All Organisms → Viruses → environmental samples → uncultured marine virus1932Open in IMG/M
3300020379|Ga0211652_10122149All Organisms → Viruses → environmental samples → uncultured marine virus789Open in IMG/M
3300020396|Ga0211687_10209303All Organisms → Viruses → environmental samples → uncultured marine virus788Open in IMG/M
3300020413|Ga0211516_10159976All Organisms → Viruses → environmental samples → uncultured marine virus1048Open in IMG/M
3300020419|Ga0211512_10449103All Organisms → Viruses → environmental samples → uncultured marine virus578Open in IMG/M
3300020421|Ga0211653_10226470All Organisms → Viruses → environmental samples → uncultured marine virus817Open in IMG/M
3300020428|Ga0211521_10212901All Organisms → Viruses → environmental samples → uncultured marine virus880Open in IMG/M
3300020438|Ga0211576_10161790All Organisms → Viruses → Predicted Viral1207Open in IMG/M
3300020469|Ga0211577_10366858All Organisms → Viruses → environmental samples → uncultured marine virus897Open in IMG/M
3300020475|Ga0211541_10091962All Organisms → Viruses → environmental samples → uncultured marine virus1502Open in IMG/M
3300021335|Ga0213867_1000239Not Available25349Open in IMG/M
3300021347|Ga0213862_10153796All Organisms → Viruses → environmental samples → uncultured marine virus809Open in IMG/M
3300021375|Ga0213869_10359980All Organisms → Viruses → environmental samples → uncultured marine virus605Open in IMG/M
3300021957|Ga0222717_10486035All Organisms → Viruses → environmental samples → uncultured marine virus667Open in IMG/M
3300021959|Ga0222716_10089454All Organisms → Viruses → Predicted Viral2099Open in IMG/M
3300021960|Ga0222715_10416579All Organisms → Viruses → environmental samples → uncultured marine virus731Open in IMG/M
3300022061|Ga0212023_1036915All Organisms → Viruses → environmental samples → uncultured marine virus679Open in IMG/M
3300022065|Ga0212024_1039001All Organisms → Viruses → environmental samples → uncultured marine virus821Open in IMG/M
3300022065|Ga0212024_1106435All Organisms → Viruses → environmental samples → uncultured marine virus500Open in IMG/M
3300022068|Ga0212021_1025616All Organisms → Viruses → Predicted Viral1129Open in IMG/M
3300022071|Ga0212028_1080195All Organisms → Viruses → environmental samples → uncultured marine virus610Open in IMG/M
3300022072|Ga0196889_1027567All Organisms → Viruses → Predicted Viral1160Open in IMG/M
3300022074|Ga0224906_1222567All Organisms → Viruses → environmental samples → uncultured marine virus509Open in IMG/M
3300022164|Ga0212022_1047624All Organisms → Viruses → environmental samples → uncultured marine virus663Open in IMG/M
3300022169|Ga0196903_1043067All Organisms → Viruses → environmental samples → uncultured marine virus524Open in IMG/M
3300022178|Ga0196887_1114613All Organisms → Viruses → environmental samples → uncultured marine virus586Open in IMG/M
3300022178|Ga0196887_1118862All Organisms → Viruses → environmental samples → uncultured marine virus570Open in IMG/M
3300022178|Ga0196887_1129698All Organisms → Viruses → environmental samples → uncultured marine virus533Open in IMG/M
3300022187|Ga0196899_1053974All Organisms → Viruses → Predicted Viral1306Open in IMG/M
3300022851|Ga0222691_1001861All Organisms → Viruses → environmental samples → uncultured marine virus5666Open in IMG/M
3300024346|Ga0244775_11080063All Organisms → Viruses → environmental samples → uncultured marine virus630Open in IMG/M
3300025048|Ga0207905_1009071All Organisms → Viruses → environmental samples → uncultured marine virus1766Open in IMG/M
3300025070|Ga0208667_1023194All Organisms → Viruses → environmental samples → uncultured marine virus1181Open in IMG/M
3300025071|Ga0207896_1027214All Organisms → Viruses → environmental samples → uncultured marine virus977Open in IMG/M
3300025079|Ga0207890_1019389All Organisms → Viruses → Predicted Viral1329Open in IMG/M
3300025079|Ga0207890_1032802All Organisms → Viruses → environmental samples → uncultured marine virus942Open in IMG/M
3300025079|Ga0207890_1057958All Organisms → Viruses → environmental samples → uncultured marine virus642Open in IMG/M
3300025084|Ga0208298_1021715All Organisms → Viruses → Predicted Viral1416Open in IMG/M
3300025110|Ga0208158_1024281All Organisms → Viruses → Predicted Viral1573Open in IMG/M
3300025120|Ga0209535_1057527All Organisms → Viruses → Predicted Viral1611Open in IMG/M
3300025138|Ga0209634_1048058All Organisms → Viruses → environmental samples → uncultured marine virus2125Open in IMG/M
3300025138|Ga0209634_1123928All Organisms → Viruses → Predicted Viral1098Open in IMG/M
3300025168|Ga0209337_1076915All Organisms → Viruses → Predicted Viral1630Open in IMG/M
3300025168|Ga0209337_1281614All Organisms → Viruses → environmental samples → uncultured marine virus615Open in IMG/M
3300025508|Ga0208148_1009262All Organisms → Viruses → environmental samples → uncultured marine virus3069Open in IMG/M
3300025508|Ga0208148_1103585All Organisms → Viruses → environmental samples → uncultured marine virus609Open in IMG/M
3300025508|Ga0208148_1116225All Organisms → Viruses → environmental samples → uncultured marine virus557Open in IMG/M
3300025637|Ga0209197_1050215All Organisms → Viruses → environmental samples → uncultured marine virus1430Open in IMG/M
3300025641|Ga0209833_1009165All Organisms → Viruses → Predicted Viral4604Open in IMG/M
3300025645|Ga0208643_1022894All Organisms → Viruses → Predicted Viral2158Open in IMG/M
3300025652|Ga0208134_1140981All Organisms → Viruses → environmental samples → uncultured marine virus618Open in IMG/M
3300025676|Ga0209657_1000979Not Available17852Open in IMG/M
3300025676|Ga0209657_1180813All Organisms → Viruses → environmental samples → uncultured marine virus572Open in IMG/M
3300025690|Ga0209505_1097051All Organisms → Viruses → environmental samples → uncultured marine virus847Open in IMG/M
3300025699|Ga0209715_1203007All Organisms → Viruses → environmental samples → uncultured marine virus619Open in IMG/M
3300025803|Ga0208425_1089702All Organisms → Viruses → environmental samples → uncultured marine virus726Open in IMG/M
3300025806|Ga0208545_1166170All Organisms → Viruses → environmental samples → uncultured marine virus515Open in IMG/M
3300025810|Ga0208543_1031938All Organisms → Viruses → Predicted Viral1323Open in IMG/M
3300025822|Ga0209714_1047141All Organisms → Viruses → environmental samples → uncultured marine virus1423Open in IMG/M
3300025830|Ga0209832_1153017All Organisms → Viruses → environmental samples → uncultured marine virus678Open in IMG/M
3300025886|Ga0209632_10263731Not Available875Open in IMG/M
3300027522|Ga0209384_1013142All Organisms → Viruses → Predicted Viral2845Open in IMG/M
3300027779|Ga0209709_10166823All Organisms → Viruses → environmental samples → uncultured marine virus1061Open in IMG/M
3300027801|Ga0209091_10263929All Organisms → Viruses → environmental samples → uncultured marine virus831Open in IMG/M
3300027810|Ga0209302_10470383All Organisms → Viruses → environmental samples → uncultured marine virus560Open in IMG/M
3300027838|Ga0209089_10318337All Organisms → Viruses → environmental samples → uncultured marine virus882Open in IMG/M
3300027906|Ga0209404_10342062All Organisms → Viruses → environmental samples → uncultured marine virus963Open in IMG/M
3300028194|Ga0257106_1169430All Organisms → Viruses → environmental samples → uncultured marine virus761Open in IMG/M
3300028672|Ga0257128_1063706All Organisms → Viruses → environmental samples → uncultured marine virus762Open in IMG/M
3300029448|Ga0183755_1016690All Organisms → Viruses → Predicted Viral2585Open in IMG/M
3300029448|Ga0183755_1039668Not Available1285Open in IMG/M
3300029448|Ga0183755_1042435Not Available1216Open in IMG/M
3300029448|Ga0183755_1048335All Organisms → Viruses → environmental samples → uncultured marine virus1089Open in IMG/M
3300029787|Ga0183757_1025764Not Available1314Open in IMG/M
3300031140|Ga0308024_1087708All Organisms → Viruses → environmental samples → uncultured marine virus777Open in IMG/M
3300031141|Ga0308021_10090049All Organisms → Viruses → Predicted Viral1238Open in IMG/M
3300031510|Ga0308010_1052765All Organisms → Viruses → environmental samples → uncultured marine virus1662Open in IMG/M
3300031578|Ga0307376_10722188All Organisms → Viruses → environmental samples → uncultured marine virus623Open in IMG/M
3300031629|Ga0307985_10085382All Organisms → Viruses → environmental samples → uncultured marine virus1269Open in IMG/M
3300031659|Ga0307986_10050407All Organisms → Viruses → environmental samples → uncultured marine virus2178Open in IMG/M
3300031659|Ga0307986_10226559All Organisms → Viruses → environmental samples → uncultured marine virus820Open in IMG/M
3300031695|Ga0308016_10227348All Organisms → Viruses → environmental samples → uncultured marine virus708Open in IMG/M
3300031705|Ga0308003_1149473All Organisms → Viruses → environmental samples → uncultured marine virus719Open in IMG/M
3300031774|Ga0315331_10636606All Organisms → Viruses → environmental samples → uncultured marine virus760Open in IMG/M
3300031851|Ga0315320_10664976All Organisms → Viruses → environmental samples → uncultured marine virus674Open in IMG/M
3300032047|Ga0315330_10336049All Organisms → Viruses → environmental samples → uncultured marine virus945Open in IMG/M
3300032255|Ga0316209_1095678All Organisms → Viruses → environmental samples → uncultured marine virus809Open in IMG/M
3300032274|Ga0316203_1229535All Organisms → Viruses → environmental samples → uncultured marine virus510Open in IMG/M
3300034418|Ga0348337_077532All Organisms → Viruses → Predicted Viral1177Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine23.73%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater22.46%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.68%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine7.63%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine5.51%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.39%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine3.39%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.27%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.27%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.27%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.27%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.27%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.27%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.27%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.85%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.85%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.85%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.85%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.42%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater0.42%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.42%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.42%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.42%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.42%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.42%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.42%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.42%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.42%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.42%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001352Pelagic Microbial community sample from North Sea - COGITO 998_met_07EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005078Microbial Community from Halfdan Field MHBA5EnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008221Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66EnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009447Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017733Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020413Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092)EnvironmentalOpen in IMG/M
3300020419Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020475Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300022851Saline water microbial communities from Ace Lake, Antarctica - #1237EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025110Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025637Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 (SPAdes)EnvironmentalOpen in IMG/M
3300025641Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025676Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025699Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027522Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG058-DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028194Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10mEnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031140Marine microbial communities from water near the shore, Antarctic Ocean - #420EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031659Marine microbial communities from Ellis Fjord, Antarctic Ocean - #82EnvironmentalOpen in IMG/M
3300031695Marine microbial communities from water near the shore, Antarctic Ocean - #233EnvironmentalOpen in IMG/M
3300031705Marine microbial communities from water near the shore, Antarctic Ocean - #36EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032255Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyriteEnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1005379043300000101MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDRKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
DelMOSum2010_1008438913300000101MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSSPDKRELLVLNKIYGGNNG*
DelMOSum2010_1020392813300000101MarineRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG*
DelMOSum2011_1005584933300000115MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNQ*
DelMOSpr2010_1012800513300000116MarineMFRVIIEGKFRENPINLSRAVKLLYXQDXTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
DelMOWin2010_1004973153300000117MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNE*
DelMOWin2010_1013577433300000117MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSSP
DelMOWin2010_1023838813300000117MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPXTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
SI47jul10_100mDRAFT_100429813300000148MarineVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGDNG*
BBAY92_1009985923300000947Macroalgal SurfaceVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG*
BBAY94_1013321023300000949Macroalgal SurfaceVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
JGI20157J14317_1006236423300001352Pelagic MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDXKPSIRVVTVPTSSDXRELLVLNKIYGGDNG*
JGI24006J15134_1007378013300001450MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKIGYIQIVKVYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGN
JGI24006J15134_1009440423300001450MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
JGI24006J15134_1009678443300001450MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSVRVVTIPTSSDKRELLVLNKIYGGNNE*
JGI24006J15134_1014504123300001450MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGDNG*
JGI24006J15134_1021172933300001450MarineLEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
JGI24005J15628_1010947913300001589MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGG
JGI24005J15628_1021056523300001589MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNK
KVRMV2_100026318153300002231Marine SedimentVFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0066223_110550913300004461MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0070770_1014391313300005078WaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0075462_1024464623300006027AqueousLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0075466_102079983300006029AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSS
Ga0075441_1007107853300006164MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTIPTSSDKRELLVLNKIYGGDNG*
Ga0075495_109635213300006399AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKI
Ga0075495_109697613300006399AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKI
Ga0075496_133775813300006419AqueousLENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0070744_1009682323300006484EstuarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0075461_1020368223300006637AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0098038_121979513300006735MarineQRRLKVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0098037_106883013300006737MarineRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0098037_108822833300006737MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0098037_115320223300006737MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG*
Ga0098037_121820533300006737MarineFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNQ*
Ga0098048_113486013300006752MarineGQSTYYIYHHLLMQRRLKVFRVILENKFQENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNGI*
Ga0098054_126678123300006789MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
Ga0070749_1050689823300006802AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKREL
Ga0070754_1007781223300006810AqueousMFRVIIEGKFRENPINLSRAIKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0070750_1009730713300006916AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG*
Ga0070750_1044067213300006916AqueousNLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0070746_1017823213300006919AqueousRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG*
Ga0070748_116540113300006920AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYG
Ga0098060_112998813300006921MarineRLRVFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRNKKPSIRVVTIPSGSDKRELLVLNKIYGGNQ*
Ga0098060_122645223300006921MarineVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVL
Ga0098045_114421613300006922MarineSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNGI*
Ga0098041_101174643300006928MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPNKRELLVLNKIYGGNNG*
Ga0098041_110735133300006928MarineVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0098036_117643913300006929MarineHQSSGQLKHGQSICYIYQDLLTQRRLKVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0098046_103862713300006990MarineRRLRVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0075468_1003496013300007229AqueousVDLLTTKRLTMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNK
Ga0075463_1007788533300007236AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
Ga0070753_107599143300007346AqueousVDLLTIKRLIMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0099847_109595413300007540AqueousNLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
Ga0105748_1022850913300007992Estuary WaterVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG*
Ga0114916_103630413300008221Deep OceanMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKENILWWKKYFLKVIHLRILYPKMGYIQIVKVYRDKIPSVRVVTVPTSSDKRELLVLNKIYGGDNEA*
Ga0115550_117644313300009076Pelagic MarineVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKREL
Ga0115552_103110383300009077Pelagic MarineFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0102814_1056998623300009079EstuarineVDLLTIKRLIMFRVLLEGKFHENPINLSRAVKLLYKQDFTGSIRNENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG*
Ga0114918_1031437323300009149Deep SubsurfaceMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDRKPSIRAVTVPTSSDKRELLVLNKIYGGDNG*
Ga0114995_1017014613300009172MarineGQQKHGQTTYYGLVDLLATKRLTMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0114996_1046104033300009173MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSVRVVTIPTSSDKRELLVLNKIYGGDNG*
Ga0114998_1015344543300009422MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0114997_1016171133300009425MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVITIPTSSDKRELLVLNKIYGGNNG*
Ga0114997_1039976213300009425MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0115545_120156313300009433Pelagic MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKR
Ga0115556_132142923300009437Pelagic MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0115561_106919013300009440Pelagic MarineVDLLTIKRLIMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDRKPSIRVVTVPTSSDKRELLVLNKIYGGDN
Ga0115557_124329613300009443Pelagic MarineVFRVILEGKVRENPINLRRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG*
Ga0115560_108609513300009447Pelagic MarineIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0115004_1017358033300009526MarineVDLLITERLIMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0115004_1049588913300009526MarineNPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0115011_1055427223300009593MarineVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSVRVVTIPSGSDKRELLVLNKIYGGNQ*
Ga0114911_115851913300009603Deep OceanVDLLTIKRVIMFRVILEGKFRENPINLSRAVKLLYNQNFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGN
Ga0114901_115580923300009604Deep OceanVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG*
Ga0115104_1117452933300009677MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
Ga0115105_1067800943300009679MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSASDKRELLVLNKIYGGNNG*
Ga0115000_1044912423300009705MarineVDLLITERLIMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRLEHMLWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTIPATTSSDKRELLVLNKIYGGDNE*
Ga0098056_101669613300010150MarineGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0098056_125967623300010150MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0098061_101037323300010151MarineVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0098059_116640033300010153MarineRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG*
Ga0129324_1019696023300010368Freshwater To Marine Saline GradientMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLKKIYGGNNG*
Ga0133547_1143282523300010883MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSVRVVTVPTSSDKRELLVLNKIYGGDNG*
Ga0114934_1005063343300011013Deep SubsurfaceVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNE*
Ga0160422_1029330323300012919SeawaterVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG*
Ga0163179_1019685143300012953SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ*
Ga0129327_1070587713300013010Freshwater To Marine Saline GradientSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG*
Ga0180120_1008313453300017697Freshwater To Marine Saline GradientVDLLTLQRLILFRVIIEEQFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0181369_105636013300017708MarineQDLLTQRRLGVFRVILEGKFRENPINLSKAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0181369_106494633300017708MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0181387_100909873300017709SeawaterPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181387_104564323300017709SeawaterHQSSGLLKHGQSTYYIYHHLLMQRRLRVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181387_107113713300017709SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLV
Ga0181403_102023143300017710SeawaterMFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181391_106834633300017713SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQXKKLEKDFGNIM
Ga0181412_109131413300017714SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSSSDKRELLVLNKIYGGNNG
Ga0181404_111271513300017717SeawaterLTIKRLIMFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181404_114680513300017717SeawaterVFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181390_104540133300017719SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181390_106280333300017719SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQVVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181383_103238123300017720SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181383_104009553300017720SeawaterGQSTYYIYHHLLMQRRLRVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181381_103983223300017726SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181381_106017013300017726SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0181401_106505113300017727SeawaterMFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181417_104031413300017730SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181417_113975423300017730SeawaterAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSASDKRELLVLNKIYGGNNG
Ga0181416_114457413300017731SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSSSDKRELLVLNKIYGGNNG
Ga0181415_115798523300017732SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181426_101950553300017733SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181426_109537413300017733SeawaterNPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181431_102696833300017735SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSASDKRELLVLNKIYGGNNG
Ga0187218_103896953300017737SeawaterMFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181418_117455523300017740SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSASDKRELLVLNKIYGGNNG
Ga0181421_107881333300017741SeawaterGKFRENPINLSRAVKLLYNQDCTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181399_108067933300017742SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNTLYGGNNG
Ga0181399_108359133300017742SeawaterFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0181402_109713223300017743SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGSNNG
Ga0181393_104090153300017748SeawaterMFRVILEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181393_104831343300017748SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181393_109835433300017748SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQVVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGG
Ga0181393_112593713300017748SeawaterLTIKRLIMFRVILEGKFRVNPINISRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181392_114897113300017749SeawaterVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDIKPSIRVVTIPSSPDKRELLVLNKIYGSNQ
Ga0181405_113847323300017750SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0187219_111505533300017751SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQXKKLEK
Ga0181400_107198743300017752SeawaterLTKKRLIMFRVIIKKKFKEKTKNLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181411_120009823300017755SeawaterLEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181420_121814013300017757SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQXKKLEKDFGNIMMY
Ga0181414_102873413300017759SeawaterILEGKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181414_118874823300017759SeawaterVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181408_106013943300017760SeawaterVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRERLVLKKIYGGNNG
Ga0181408_107005733300017760SeawaterRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0181422_113528313300017762SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0181410_117242423300017763SeawaterIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0187221_105055533300017769SeawaterVFRVILENKFRENPINLNRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0187217_120230123300017770SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGN
Ga0181430_109109013300017772SeawaterERLIMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0181394_113908513300017776SeawaterVDLLTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGSNQ
Ga0181423_117725613300017781SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSASDKRELLVLNKIYGGNNG
Ga0181380_121547213300017782SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181379_125504913300017783SeawaterILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0181379_127634113300017783SeawaterMFRVILKGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0181600_1055578823300018036Salt MarshVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSSPDKRELLVLNKIYG
Ga0194029_100120623300019751FreshwaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0181602_1020070533300020173Salt MarshVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSSPDKRELLVLNKIYGGNNG
Ga0181596_1007850513300020177Salt MarshKHLSFGLLKHGQNICYIYQDLLTQRRLRVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0206131_1008247953300020185SeawaterMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0211652_1012214913300020379MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELL
Ga0211687_1020930313300020396MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSAPDKRELLVLNKIYGGNNG
Ga0211516_1015997623300020413MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0211512_1044910323300020419MarineSSGLLKHGQSTYYIYHHLLMQRRLRVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0211653_1022647033300020421MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSG
Ga0211521_1021290143300020428MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYG
Ga0211576_1016179023300020438MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0211577_1036685843300020469MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPS
Ga0211541_1009196223300020475MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0213867_1000239333300021335SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0213862_1015379623300021347SeawaterVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0213869_1035998023300021375SeawaterRLKVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0222717_1048603513300021957Estuarine WaterVDLQITERLIMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0222716_1008945453300021959Estuarine WaterMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPTSSDNRELLVLNKIYGGNNG
Ga0222715_1041657933300021960Estuarine WaterMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0212023_103691523300022061AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0212024_103900123300022065AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0212024_110643513300022065AqueousVFRVILKGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0212021_102561643300022068AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0212028_108019523300022071AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0196889_102756743300022072AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0224906_122256723300022074SeawaterNLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0212022_104762433300022164AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYG
Ga0196903_104306713300022169AqueousLEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0196887_111461313300022178AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSS
Ga0196887_111886223300022178AqueousMFRVILENKFKENPINLSRAIKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0196887_112969823300022178AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLN
Ga0196899_105397413300022187AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSD
Ga0222691_100186193300022851Saline WaterMYKVIIEGKFRENPINLARAVKLLYNQQFTGSIRQEHLLWWKKYFLKVIHLPILYPKRGYIQMVKIYRDKTPSVRVVTIPTSSDKRELLVLNKIYGGDNG
Ga0244775_1108006323300024346EstuarineNKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0207905_100907163300025048MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0208667_102319413300025070MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPS
Ga0207896_102721413300025071MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKIGYIQIVKVYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNN
Ga0207890_101938913300025079MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYG
Ga0207890_103280233300025079MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKIGYIQIVKVYRDKKPSIRVVTIPSGSDKRE
Ga0207890_105795813300025079MarineAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0208298_102171543300025084MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0208158_102428123300025110MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPNKRELLVLNKIYGGNNG
Ga0209535_105752723300025120MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKLSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0209634_104805863300025138MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKIGYIQIVKVYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0209634_112392823300025138MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSLDKRELLVLNKIYGGNNG
Ga0209337_107691553300025168MarineMFRVILEGKFRENPINLSRAVKLLYNQNFTGSIRLENLLWWKKYFLKIIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0209337_128161423300025168MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0208148_1009262123300025508AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0208148_110358523300025508AqueousMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKTGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNG
Ga0208148_111622513300025508AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIY
Ga0209197_105021553300025637Pelagic MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDRKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0209833_1009165163300025641Pelagic MarineFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0208643_102289473300025645AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPS
Ga0208134_114098123300025652AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLV
Ga0209657_1000979263300025676MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVVTIPTSSDKRELLVLNKIYGGNNG
Ga0209657_118081323300025676MarineRVIIENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDRKPSIRAVTVPTSSDKRELLVLNKIYGGDNG
Ga0209505_109705123300025690Pelagic MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0209715_120300713300025699Pelagic MarineNLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0208425_108970213300025803AqueousKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0208545_116617023300025806AqueousMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPT
Ga0208543_103193833300025810AqueousVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNQ
Ga0209714_104714123300025822Pelagic MarineMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0209832_115301723300025830Pelagic MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0209632_1026373133300025886Pelagic MarineRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0209384_101314233300027522MarineMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKENILWWKKYFLKVIHLRILYPKMGYIQIVKVYRDKIPSVRVVTVPTSSDKRELLVLNKIYGGDNEA
Ga0209709_1016682323300027779MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSIRVITIPTSSDKRELLVLNKIYGGNNG
Ga0209091_1026392913300027801MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRLEHMLWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTIPATTSSDKRELLVLNKIYGGDNE
Ga0209302_1047038323300027810MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0209089_1031833723300027838MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSVRVVTIPTSSDKRELLVLNKIYGGDNG
Ga0209404_1034206223300027906MarineVFRVIIEKKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKKPSVRVVTIPSGSDKRELLVLNKIYGGNQ
Ga0257106_116943013300028194MarineMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPS
Ga0257128_106370623300028672MarineLEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVITIPSGSDKRELLVLNKIYGGNNG
Ga0183755_101669043300029448MarineMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSSSDKRELLVLNKIYGGNNE
Ga0183755_103966813300029448MarineTIKRLIMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0183755_104243513300029448MarineRLRVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0183755_104833523300029448MarineVFRVILENKFRENPINLSRAVKLLYNQDFTGSIRKENLLWWKKYFLKVIHLPILYPKKGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0183757_102576423300029787MarineVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRNKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0308024_108770823300031140MarineMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKTPSVRVVTIPTSSDKRELLVLNKIYGGDNG
Ga0308021_1009004933300031141MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKTPSVRVVTIPTSSDKRELLVLNKIYGGDNG
Ga0308010_105276553300031510MarineMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKENILWWKKYFLKVIHLRILYPKMGYIQIVKVYRDKIPSIRVVTVPTSSDKRELLVLNKIYGGDNEA
Ga0307376_1072218813300031578SoilAVKLLYNQDFTGSIRLENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSSPDKRELLVLNKIYGGNNG
Ga0307985_1008538213300031629MarineIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKTPSVRVVTIPTSSDRRELLVLNKIYGGDNET
Ga0307986_1005040763300031659MarineMFRVIIENKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKRGYIQIVKIYRDKTPSVRVVTIPTSSDRRELLVLNKIYGGDNG
Ga0307986_1022655923300031659MarineMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKEHILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKTPSVRVVTIPTSSDKRELLVLNKIYGGDNEA
Ga0308016_1022734813300031695MarineMFRVIIENKFRENPINLSRAIKLLYNQDFTGSIRLENILWWKKYFLKVIHLPILYPKRGYIQIVKVYRDKKPSVRVVTIPATTSSDKRELLILNKIYGGDNE
Ga0308003_114947313300031705MarineGQNTYYGYHHSQITKRLTMYRVIIEGKFRENPINLARAVKLLYNQQFTGSIRKENILWWKKYFLKVIHLRILYPKMGYIQIVKVYRDKIPSIRVVTVPTSSDKRELLVLNKIYGGDNEA
Ga0315331_1063660623300031774SeawaterMFRVILENKFRENPINLSRAVKLLYNQDFTGSIRLENIIWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0315320_1066497613300031851SeawaterMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSS
Ga0315330_1033604923300032047SeawaterVFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPSGSDKRELLVLNKIYGGNNG
Ga0316209_109567833300032255Microbial MatMFRVILEGKFQENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLRVLYPKTGYIQIVKIYRDKKPSIRVVTIPS
Ga0316203_122953513300032274Microbial MatMFRVIIKGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0348337_077532_466_7683300034418AqueousMFRVILEGKFRENPINLSRAVKLLYNQDFTGSIRLENLLWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.