Scaffold Ga0116022_1000011

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116022_1000011

Scaffold Ga0116022_1000011

Overview

Basic Information
Taxon OID	3300008987 Open in IMG/M
Scaffold ID	Ga0116022_1000011 Open in IMG/M
Source Dataset Name	Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	204401
Total Scaffold Genes	172 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	55 (31.98%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Source Dataset Sampling Location
Location Name	Alberta, Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116022_1000011170	F030405	N/A	MHRGGGACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.