Scaffold Ga0103480_102364

Overview

Basic Information

• Taxon OID: 3300008915
• Scaffold ID: Ga0103480_102364
• Source Dataset Name: Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Sodertorn University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 679
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water → Microbial Communities Of Nutrient Treated Water From Blanes Bay, Barcelona, Spain

Source Dataset Sampling Location

• Location Name: Barcelona, Spain
• Coordinates
  • Lat. (^o): 41.666
  • Long. (^o): 2.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F034583	Metagenome / Metatranscriptome	174	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0103480_1023641	F034583	N/A	ESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSHELEKTCTPFYGNTFKFNDTIV