Scaffold Ga0115930_1035886

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115930_1035886

Scaffold Ga0115930_1035886

Overview

Basic Information
Taxon OID	3300008886 Open in IMG/M
Scaffold ID	Ga0115930_1035886 Open in IMG/M
Source Dataset Name	Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	HPI Heinrich-Pette-Institut
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1257
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated → Microbial Communities Associated With Unicellular Green Alga Micrasterias Crux-Melitensis, Germany - (Mzch: 98)

Source Dataset Sampling Location
Location Name	Germany
Coordinates	Lat. (^o)	53.560155	Long. (^o)	9.859606	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087448	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115930_10358863	F087448	AGGA	MTNIPVTASGDQKPETPATPQQQTQNPPKPADKPSEQQK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.