Metagenome / Metatranscriptome Family F087448

Basic Information
Family ID	F087448
Family Type	Metagenome / Metatranscriptome
Number of Sequences	110
Average Sequence Length	42 residues
Representative Sequence	MTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK
Number of Associated Samples	98
Number of Associated Scaffolds	110

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	71.56 %
% of genes near scaffold ends (potentially truncated)	22.73 %
% of genes from short scaffolds (< 2000 bps)	91.82 %
Associated GOLD sequencing projects	94
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.14

Most Common Taxonomy
Group	Unclassified (68.182 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.364 % of family members)
Environment Ontology (ENVO)	Unclassified (30.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (47.273 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Fibrous	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 110 Family Scaffolds
PF08379	Bact_transglu_N	4.55
PF04392	ABC_sub_bind	3.64
PF06684	AA_synth	2.73
PF03401	TctC	1.82
PF07536	HWE_HK	1.82
PF13467	RHH_4	0.91
PF13545	HTH_Crp_2	0.91
PF00027	cNMP_binding	0.91
PF13340	DUF4096	0.91
PF13581	HATPase_c_2	0.91
PF00154	RecA	0.91
PF06186	DUF992	0.91
PF13604	AAA_30	0.91
PF04545	Sigma70_r4	0.91
PF06689	zf-C4_ClpX	0.91
PF03734	YkuD	0.91

COG ID	Name	Functional Category	% Frequency in 110 Family Scaffolds
COG1305	Transglutaminase-like enzyme, putative cysteine protease	Posttranslational modification, protein turnover, chaperones [O]	4.55
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	3.64
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.82
COG3920	Two-component sensor histidine kinase, HisKA and HATPase domains	Signal transduction mechanisms [T]	1.82
COG4251	Bacteriophytochrome (light-regulated signal transduction histidine kinase)	Signal transduction mechanisms [T]	1.82
COG0468	RecA/RadA recombinase	Replication, recombination and repair [L]	0.91
COG1376	Lipoprotein-anchoring transpeptidase ErfK/SrfK	Cell wall/membrane/envelope biogenesis [M]	0.91
COG3034	Murein L,D-transpeptidase YafK	Cell wall/membrane/envelope biogenesis [M]	0.91

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
All Organisms	root	All Organisms	31.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
cellular organisms	root	All Organisms → cellular organisms	31.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	31.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	25.45 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	19.09 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	0.91 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14.55 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.82 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.82 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	1.82 %
Beijerinckiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae	0.91 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.91 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Rhodoplanes	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes	1.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.82 %
unclassified Beijerinckiaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae	0.91 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.91 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
unclassified Rhodoplanes	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes	1.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.82 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.91 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.91 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	68.18 %
Rhodoplanes sp. Z2-YC6860	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	1.82 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.82 %
Beijerinckiaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	0.91 %
Microvirga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	0.91 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.91 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.91 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	0.91 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459014\|G1P06HT01CP1G1	Not Available	653	Open in IMG/M
3300001686\|C688J18823_10199110	Not Available	1352	Open in IMG/M
3300002568\|C688J35102_117700524	Not Available	500	Open in IMG/M
3300003312\|P12013IDBA_1036330	All Organisms → cellular organisms → Bacteria → Proteobacteria	1416	Open in IMG/M
3300003996\|Ga0055467_10062067	All Organisms → cellular organisms → Bacteria → Proteobacteria	992	Open in IMG/M
3300003998\|Ga0055472_10256293	Not Available	553	Open in IMG/M
3300004067\|Ga0055485_10024242	Not Available	1208	Open in IMG/M
3300004081\|Ga0063454_100837603	Not Available	717	Open in IMG/M
3300004082\|Ga0062384_100525669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium	788	Open in IMG/M
3300004153\|Ga0063455_100304018	Not Available	877	Open in IMG/M
3300004157\|Ga0062590_100104152	All Organisms → cellular organisms → Bacteria	1807	Open in IMG/M
3300004157\|Ga0062590_100196719	Not Available	1451	Open in IMG/M
3300004479\|Ga0062595_100614265	Not Available	850	Open in IMG/M
3300005327\|Ga0070658_11700176	Not Available	546	Open in IMG/M
3300005330\|Ga0070690_100819710	Not Available	723	Open in IMG/M
3300005341\|Ga0070691_10410758	Not Available	765	Open in IMG/M
3300005434\|Ga0070709_10491033	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	931	Open in IMG/M
3300005434\|Ga0070709_11049989	Not Available	650	Open in IMG/M
3300005447\|Ga0066689_10940275	Not Available	533	Open in IMG/M
3300005471\|Ga0070698_100863554	All Organisms → cellular organisms → Bacteria	850	Open in IMG/M
3300005543\|Ga0070672_100774632	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	843	Open in IMG/M
3300005544\|Ga0070686_100702339	Not Available	807	Open in IMG/M
3300005548\|Ga0070665_100168390	Not Available	2193	Open in IMG/M
3300005563\|Ga0068855_100590154	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1199	Open in IMG/M
3300005578\|Ga0068854_101974327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	537	Open in IMG/M
3300005616\|Ga0068852_101459103	Not Available	706	Open in IMG/M
3300005842\|Ga0068858_101143022	Not Available	765	Open in IMG/M
3300005842\|Ga0068858_101240459	Not Available	733	Open in IMG/M
3300006028\|Ga0070717_10308401	All Organisms → cellular organisms → Bacteria → Proteobacteria	1408	Open in IMG/M
3300006046\|Ga0066652_100393727	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga	1260	Open in IMG/M
3300006047\|Ga0075024_100153014	Not Available	1052	Open in IMG/M
3300006047\|Ga0075024_100618588	Not Available	584	Open in IMG/M
3300006048\|Ga0075363_100443465	Not Available	766	Open in IMG/M
3300006178\|Ga0075367_10165980	All Organisms → cellular organisms → Bacteria	1374	Open in IMG/M
3300006178\|Ga0075367_10389308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	881	Open in IMG/M
3300006178\|Ga0075367_10923122	Not Available	557	Open in IMG/M
3300006353\|Ga0075370_10609149	Not Available	662	Open in IMG/M
3300006791\|Ga0066653_10304658	All Organisms → cellular organisms → Bacteria → Proteobacteria	803	Open in IMG/M
3300006844\|Ga0075428_101004721	Not Available	883	Open in IMG/M
3300006854\|Ga0075425_101846964	Not Available	678	Open in IMG/M
3300006881\|Ga0068865_101334933	Not Available	638	Open in IMG/M
3300006904\|Ga0075424_101593648	Not Available	692	Open in IMG/M
3300008886\|Ga0115930_1035886	Not Available	1257	Open in IMG/M
3300009012\|Ga0066710_102534389	Not Available	740	Open in IMG/M
3300009012\|Ga0066710_103382740	Not Available	607	Open in IMG/M
3300009053\|Ga0105095_10071287	Not Available	1873	Open in IMG/M
3300009094\|Ga0111539_10890399	Not Available	1035	Open in IMG/M
3300009098\|Ga0105245_11350289	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	762	Open in IMG/M
3300009098\|Ga0105245_11807547	All Organisms → cellular organisms → Bacteria → Proteobacteria	664	Open in IMG/M
3300009098\|Ga0105245_12966189	Not Available	526	Open in IMG/M
3300009545\|Ga0105237_12015965	Not Available	586	Open in IMG/M
3300009553\|Ga0105249_10218801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	1873	Open in IMG/M
3300010159\|Ga0099796_10278328	Not Available	703	Open in IMG/M
3300010371\|Ga0134125_10531013	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1302	Open in IMG/M
3300010375\|Ga0105239_11547916	Not Available	766	Open in IMG/M
3300010396\|Ga0134126_10454038	Not Available	1483	Open in IMG/M
3300010400\|Ga0134122_10393080	Not Available	1222	Open in IMG/M
3300011414\|Ga0137442_1108537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	607	Open in IMG/M
3300012212\|Ga0150985_102518797	All Organisms → cellular organisms → Bacteria	1089	Open in IMG/M
3300012227\|Ga0137449_1103917	Not Available	618	Open in IMG/M
3300012469\|Ga0150984_100903548	Not Available	842	Open in IMG/M
3300012930\|Ga0137407_10567195	Not Available	1064	Open in IMG/M
3300012957\|Ga0164303_11113371	Not Available	571	Open in IMG/M
3300012961\|Ga0164302_10172222	Not Available	1300	Open in IMG/M
3300012984\|Ga0164309_11083504	Not Available	665	Open in IMG/M
3300014270\|Ga0075325_1013108	Not Available	1474	Open in IMG/M
3300014310\|Ga0075331_1078610	Not Available	756	Open in IMG/M
3300014322\|Ga0075355_1115424	Not Available	682	Open in IMG/M
3300015087\|Ga0167637_1003311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2459	Open in IMG/M
3300015245\|Ga0137409_11190093	Not Available	603	Open in IMG/M
3300017792\|Ga0163161_11185115	All Organisms → cellular organisms → Bacteria → Proteobacteria	660	Open in IMG/M
3300017965\|Ga0190266_10011973	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2258	Open in IMG/M
3300017965\|Ga0190266_10594062	Not Available	668	Open in IMG/M
3300017965\|Ga0190266_10682520	Not Available	638	Open in IMG/M
3300018007\|Ga0187805_10278872	All Organisms → cellular organisms → Bacteria	767	Open in IMG/M
3300018469\|Ga0190270_13363619	Not Available	507	Open in IMG/M
3300018481\|Ga0190271_11713085	Not Available	742	Open in IMG/M
3300019377\|Ga0190264_12355205	Not Available	502	Open in IMG/M
3300020167\|Ga0194035_1010666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3795	Open in IMG/M
3300021170\|Ga0210400_10090711	Not Available	2411	Open in IMG/M
3300021171\|Ga0210405_10065476	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2868	Open in IMG/M
3300021432\|Ga0210384_11833430	Not Available	512	Open in IMG/M
3300022886\|Ga0247746_1062990	Not Available	868	Open in IMG/M
(restricted) 3300023208\|Ga0233424_10212259	All Organisms → cellular organisms → Bacteria	775	Open in IMG/M
3300025926\|Ga0207659_10561504	Not Available	971	Open in IMG/M
3300025941\|Ga0207711_10017227	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	6005	Open in IMG/M
3300025949\|Ga0207667_10495374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1240	Open in IMG/M
3300026075\|Ga0207708_10631331	Not Available	910	Open in IMG/M
3300026535\|Ga0256867_10345428	Not Available	520	Open in IMG/M
3300026552\|Ga0209577_10273427	Not Available	1268	Open in IMG/M
3300026557\|Ga0179587_11051965	Not Available	536	Open in IMG/M
3300027835\|Ga0209515_10073361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	2437	Open in IMG/M
3300027903\|Ga0209488_10125521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1933	Open in IMG/M
3300027907\|Ga0207428_10749895	Not Available	696	Open in IMG/M
3300028381\|Ga0268264_10382615	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1348	Open in IMG/M
3300028906\|Ga0308309_11396542	Not Available	600	Open in IMG/M
3300030990\|Ga0308178_1095927	Not Available	623	Open in IMG/M
3300030990\|Ga0308178_1143139	Not Available	544	Open in IMG/M
3300031057\|Ga0170834_112860677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	706	Open in IMG/M
3300031099\|Ga0308181_1087444	Not Available	655	Open in IMG/M
3300031229\|Ga0299913_10966410	Not Available	819	Open in IMG/M
3300031424\|Ga0308179_1049572	Not Available	543	Open in IMG/M
3300031455\|Ga0307505_10268462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860	796	Open in IMG/M
3300031474\|Ga0170818_103425049	Not Available	776	Open in IMG/M
3300031562\|Ga0310886_10060682	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1753	Open in IMG/M
3300031716\|Ga0310813_11931172	Not Available	556	Open in IMG/M
3300031965\|Ga0326597_11382512	Not Available	683	Open in IMG/M
3300034268\|Ga0372943_0577295	Not Available	737	Open in IMG/M
3300034644\|Ga0370548_028259	Not Available	902	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	69.09%
Host-Associated	Host-Associated	30.00%
Engineered	Engineered	0.91%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	57.27%
Plants	Host-Associated → Plants	29.09%
Aquatic	Environmental → Aquatic	11.82%
Microbial	Host-Associated → Microbial	0.91%
Solid Waste	Engineered → Solid Waste	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.45%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.09%
Freshwater	Environmental → Aquatic → Freshwater	5.45%
Roots	Host-Associated → Plants → Roots	4.55%
Sediment	Environmental → Aquatic → Sediment	3.64%
Marine	Environmental → Aquatic → Marine	2.73%
Bacteria	Host-Associated → Microbial → Bacteria	0.91%
Grass	Engineered → Solid Waste → Grass	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.73%
Loam	Environmental → Terrestrial → Soil → Loam	11.82%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.91%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	8.18%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	4.55%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	3.64%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.73%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	2.73%
Lake	Environmental → Aquatic → Freshwater → Lake	1.82%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.82%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.91%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.91%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.91%
Composting	Engineered → Solid Waste → Grass → Composting	0.91%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	26.36%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	8.18%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.27%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.45%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	5.45%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	4.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.55%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	3.64%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.64%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	3.64%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.73%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	2.73%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	1.82%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.91%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.91%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.91%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.91%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.91%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.91%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.91%
Unclassified	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified	0.91%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.91%
Unclassified	Engineered → Solid Waste → Grass → Composting → Unclassified	0.91%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	16.36%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	5.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.45%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	4.55%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	4.55%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.64%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.64%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	3.64%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.64%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.73%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.73%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.73%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.73%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	1.82%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.82%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.82%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.82%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.82%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.82%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.82%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.82%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.91%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	0.91%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	0.91%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.91%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.91%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.91%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.91%
Ore Pile And Mine Drainage Contaminated Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Ore Pile And Mine Drainage Contaminated Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.91%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.91%
Micrasterias Crux-Melitensis (Mzch 98) Associated	Host-Associated → Microbial → Bacteria → Unclassified → Unclassified → Micrasterias Crux-Melitensis (Mzch 98) Associated	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.91%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.91%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.91%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.91%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.91%
Switchgrass, Maize And Mischanthus Litter	Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter	0.91%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459014	Litter degradation PV2	Engineered	Open in IMG/M
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300003312	Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P1 sample	Environmental	Open in IMG/M
3300003996	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2	Environmental	Open in IMG/M
3300003998	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2	Environmental	Open in IMG/M
3300004067	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2	Environmental	Open in IMG/M
3300004081	Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)	Environmental	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005447	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138	Environmental	Open in IMG/M
3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006048	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Host-Associated	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006353	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Host-Associated	Open in IMG/M
3300006791	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102	Environmental	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated	Open in IMG/M
3300008886	Microbial communities associated with unicellular green alga Micrasterias crux-melitensis, Germany - (MZCH: 98)	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012227	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT436_2	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012930	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental	Open in IMG/M
3300014270	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1	Environmental	Open in IMG/M
3300014310	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1	Environmental	Open in IMG/M
3300014322	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1	Environmental	Open in IMG/M
3300015087	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary)	Environmental	Open in IMG/M
3300015245	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300020167	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300023208 (restricted)	Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MG	Environmental	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300026552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)	Environmental	Open in IMG/M
3300026557	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal	Environmental	Open in IMG/M
3300027835	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW60B uncontaminated upgradient, 5.4 m (SPAdes)	Environmental	Open in IMG/M
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028906	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031099	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031424	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_150 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031474	Fir Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031965	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185	Environmental	Open in IMG/M
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental	Open in IMG/M
3300034644	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
2PV_04493460	2170459014	Switchgrass, Maize And Mischanthus Litter	MKDFSMTTVPVSASEPHEARTPATPQQQTQGNPPKPADKPIEQQK
C688J18823_101991103	3300001686	Soil	MTAVPISASEPQKPATPATPQQQTQANPPKPTDKPSEQQK*
C688J35102_1177005242	3300002568	Soil	MTTVPISASEPQTPATPATPQQQTQGNPPKPADKPSEQQK*
P12013IDBA_10363304	3300003312	Ore Pile And Mine Drainage Contaminated Soil	MTNVNLSTEEKKPANPPASPQQTQGNPPKPAEKPAEQQK*
Ga0055467_100620671	3300003996	Natural And Restored Wetlands	MTNVTISASEPQKPASPAPATPRQQTQGTPSKPADKPNEQQK*
Ga0055472_102562932	3300003998	Natural And Restored Wetlands	MSNVNISASEQQKPANPAPATPQQQTQGNPPKPADKAGEQQK*
Ga0055485_100242424	3300004067	Natural And Restored Wetlands	MTNIPVSASNNEQKPSTPANPQQQTQNNPPKPADKPSEQQK*
Ga0063454_1008376031	3300004081	Soil	MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0062384_1005256691	3300004082	Bog Forest Soil	MTNTPNSVSGDQKPATPANPQQQTQNPPKPADKPSEQQK*
Ga0063455_1003040182	3300004153	Soil	MTTVPVSASEPQKPATPTTPQQQTQGNPPKPADKPSEQQK*
Ga0062590_1001041524	3300004157	Soil	MTIINITASNEPQKPANPAPATPQQTQGTPSKPADKPSEQQK*
Ga0062590_1001967192	3300004157	Soil	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK*
Ga0062595_1006142652	3300004479	Soil	MKGNTMTNVNITATNEPQKPANPAPATPQQQTQGNPAKPADKPSEQQK*
Ga0070658_117001761	3300005327	Corn Rhizosphere	MTNIPVSASDDTVKPATPVTPQQQTQGNPPKPADKPSEQQK*
Ga0070690_1008197102	3300005330	Switchgrass Rhizosphere	MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK*
Ga0070691_104107582	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MTTVPVSAAEPQTPATPATPQQQTQSNPPKPADKPSEQQK*
Ga0070709_104910332	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MTNVTNSASDPQKPAAPATPQQQTQSNPQPQGSPAKPADKPSEQQK*
Ga0070709_110499892	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MTTVPISASEPQKPANPATPQQQTQGNPPKPADKPSEQQK*
Ga0066689_109402752	3300005447	Soil	MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK*
Ga0070698_1008635543	3300005471	Corn, Switchgrass And Miscanthus Rhizosphere	VLSAKDITMTNVPISASEPQKPAAPAPATPQQQTQANPKPVEKPAEQQK*
Ga0070672_1007746322	3300005543	Miscanthus Rhizosphere	MTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK*
Ga0070686_1007023394	3300005544	Switchgrass Rhizosphere	KDFSMTIVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK*
Ga0070665_1001683904	3300005548	Switchgrass Rhizosphere	MTTVPVSASEPQAPATPQQQTHATPPNPADKPSEQQK*
Ga0068855_1005901541	3300005563	Corn Rhizosphere	MTDFKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK*
Ga0068854_1019743272	3300005578	Corn Rhizosphere	VNITASNEPQKPTPATPQQQTQGNPPKPADKPSEQQK*
Ga0068852_1014591032	3300005616	Corn Rhizosphere	MTDIKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK*
Ga0068858_1011430223	3300005842	Switchgrass Rhizosphere	MTIVPVSASEPQKPATPVTPQQQTQGNPPKPADKPSEQQK*
Ga0068858_1012404591	3300005842	Switchgrass Rhizosphere	VSAAEPQAPTTPASPQQQTQANPPKPADKPSEQQK*
Ga0070717_103084012	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MTNVTNSASDSQKPAAPATPQQQTQSNPQPQGSPAKPADKPSEQQK*
Ga0066652_1003937271	3300006046	Soil	KDIAMTNVPISASEPQKPASPAPATPQQQTQANPKPVEKLAQQQK*
Ga0075024_1001530142	3300006047	Watersheds	MTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0075024_1006185883	3300006047	Watersheds	KRFFYMTNAPVSAFNDTPKPATPAPRQQQTQTNPPKPADKPSEQQK*
Ga0075363_1004434652	3300006048	Populus Endosphere	MTTVPVSTSEPQTPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0075367_101659802	3300006178	Populus Endosphere	MTTVPVSAAEPQAPTTPATPQQQTQGNPPKPADKPSEQQK*
Ga0075367_103893084	3300006178	Populus Endosphere	MTMTDVKISTSTEQKPATTPAPATPQQQTQSNPPKTGDKPNEQQK*
Ga0075367_109231223	3300006178	Populus Endosphere	MTIVPVSASEPQKPATPVTPQQQTQGNPPKPADKPGEQQK*
Ga0075370_106091492	3300006353	Populus Endosphere	MTIVPVSASEPQKPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0066653_103046581	3300006791	Soil	MTNVPISASEPQKPASPAPATPQQQTQANPKPVEKLAQQQSKLA
Ga0075428_1010047212	3300006844	Populus Rhizosphere	MTNVSINASNEPQKPTTPASTPTPQQQTQGTPKPASDKPSEQQK*
Ga0075425_1018469642	3300006854	Populus Rhizosphere	MTTVPVSASEPQKPASPATPQQQTQGNPPKPADKPSEQQK*
Ga0068865_1013349331	3300006881	Miscanthus Rhizosphere	VPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK*
Ga0075424_1015936482	3300006904	Populus Rhizosphere	MTNVPISASEPQKPASPAPATPQQQTQDNPKPATKPAEQQK*
Ga0115930_10358863	3300008886	Micrasterias Crux-Melitensis (Mzch 98) Associated	MTNIPVTASGDQKPETPATPQQQTQNPPKPADKPSEQQK*
Ga0066710_1025343892	3300009012	Grasslands Soil	MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVD
Ga0066710_1033827401	3300009012	Grasslands Soil	DTTTMTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK
Ga0105095_100712873	3300009053	Freshwater Sediment	MTNVTISASEFQKPASRAPATPQQQTQGTPVKPADKPSEQQK*
Ga0111539_108903994	3300009094	Populus Rhizosphere	MTNTPVANNDPKPATPATPQQQNQGTPKPADKPSEQQK*
Ga0105245_113502892	3300009098	Miscanthus Rhizosphere	MTNVPVSGSNPDQKPSTPATPQQQTQANPPKPADKPSEQQK*
Ga0105245_118075473	3300009098	Miscanthus Rhizosphere	VFRKGNTMTNVNITASNEPQKPTPATPQQQTQGNPPKPADKPSEQQK*
Ga0105245_129661891	3300009098	Miscanthus Rhizosphere	MTTVPVSASEPQKPATPATPQQQTQGNPPKPVDKPSEQQK*
Ga0105237_120159651	3300009545	Corn Rhizosphere	MKGFSMTTVPISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0105249_102188012	3300009553	Switchgrass Rhizosphere	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPSEQQK*
Ga0099796_102783282	3300010159	Vadose Zone Soil	MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPNEQQK*
Ga0134125_105310135	3300010371	Terrestrial Soil	MTDVKISASTEQKPANNPAPATPQQTQTNPPKTDNKPSEQQK*
Ga0105239_115479162	3300010375	Corn Rhizosphere	MITVPVSAAEPQAPTTPASPQQQTQANPPKPADKPSEQQK*
Ga0134126_104540383	3300010396	Terrestrial Soil	MTNVTNSASDPQKPATQAPATPQQQTQSNPQPAKPADKPSEQQK*
Ga0134122_103930802	3300010400	Terrestrial Soil	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPIEQQK*
Ga0137442_11085372	3300011414	Soil	MTNVTISASEPQKPASAAPVTPQQQTQGAPAKSADKPSEQQK*
Ga0150985_1025187973	3300012212	Avena Fatua Rhizosphere	SFHKKDMTMTNIPVSASDDTVKPATPVTPQQQTQGNPPKPADKPSEQQK*
Ga0137449_11039172	3300012227	Soil	MMNVTISASEPPKPASPAPVTMQQQTEGAPAKPADKPSEQQN*
Ga0137366_109801412	3300012354	Vadose Zone Soil	MTNAPVPSSGDQKPATPATPQQQTQTNPPKPADKPSEQQK*
Ga0150984_1009035481	3300012469	Avena Fatua Rhizosphere	NKSQVILKGITMTDPIRVPVTASGDNKPSTPATPQQQTQGNPPKPADKPSEQQK*
Ga0137407_105671951	3300012930	Vadose Zone Soil	IPVTASSDQKPATPATPQQQTQAPAPKPADKPNEQQK*
Ga0164303_111133711	3300012957	Soil	TVPISASEPQKPTTPAPQQQTQGNPPKPADKPIEQQK*
Ga0164302_101722222	3300012961	Soil	MTTVPVSAAEPQTPATQATPQQQTQGNPPKPADKPSEQQK*
Ga0164309_110835042	3300012984	Soil	MTTVPIAASEPQKPATLSPAVTPQQQTQGNPPKPADKPSEQQK*
Ga0075325_10131082	3300014270	Natural And Restored Wetlands	MTNVNISASEPQKPANPSPATPQQQTQGSPAKPADKPGEQQK*
Ga0075331_10786102	3300014310	Natural And Restored Wetlands	MTNVNISASEPQKPANPSPATPQQQTQGTPAKPTDKPGEQQK*
Ga0075355_11154242	3300014322	Natural And Restored Wetlands	MYSKNKTQVFLKGITMTDPIIVPVSASGDNKPATPTTPQQQTQANPPKPADKPSEQQK*
Ga0167637_10033112	3300015087	Glacier Forefield Soil	MTDTPVTGSTPEQKPAAAPATPQQQNQGSPKPADTKPNEQQK*
Ga0137409_111900931	3300015245	Vadose Zone Soil	NVPISASEPQKPASPAPATPQQQTQGNPKPADKPSEQQK*
Ga0163161_111851151	3300017792	Switchgrass Rhizosphere	HDKDISMTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK
Ga0190266_100119733	3300017965	Soil	MTNASEQEKPATPAPTPQQQTQGNPPKPADKPSEQQK
Ga0190266_105940621	3300017965	Soil	MTNIPVSASNNEQKPATPATPQQQTQSNPPKPADKPSEQQK
Ga0190266_106825202	3300017965	Soil	MTDVKISASEPQKPATPATAPATPQQQNQGTPKPADKPSEQQK
Ga0187805_102788722	3300018007	Freshwater Sediment	MVFRYFSKEFTMTNMPNSSNDQESVTSPTPQQQTQNNPPKPADKPVEQQK
Ga0190270_133636191	3300018469	Soil	MTNIPVSASSNEQKPATPATPQQQTQGNPPKPADKPSEQQK
Ga0190271_117130852	3300018481	Soil	MTNIPVTASGNEQKPVTPANPQQQTQGNPPKPADKPSEQQK
Ga0190264_123552051	3300019377	Soil	MTNTPAFANDEKKPATPATPQQNQGAPKPAEKQGEQQK
Ga0194035_10106663	3300020167	Anoxic Zone Freshwater	MTNVPVSGSTPEQKPAVAPATPQQQTQGTPKPAETAKPNEQQK
Ga0210400_100907114	3300021170	Soil	MTNVKISAFEPQKPVDPTPATPQQQTQSNPQKPAGKPGEQQK
Ga0210405_100654763	3300021171	Soil	MTSVTISASEPQKPANPTPATPQQQTQSNPTKPLDKPNEQQK
Ga0210384_118334301	3300021432	Soil	MTNVKISASEPQKPADPTAAAPQQQTQSNPQKPAGKPGEQQK
Ga0247746_10629901	3300022886	Soil	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQK
(restricted) Ga0233424_102122592	3300023208	Freshwater	LVATGAIAMTNVNLSTKEKKPANPPASPQQTQGNPPKPAEKPAEQQK
Ga0207659_105615041	3300025926	Miscanthus Rhizosphere	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSE
Ga0207711_100172277	3300025941	Switchgrass Rhizosphere	MTTVPVSASEPQKPATPATPQQQTQGNPPKPADKPIEQQK
Ga0207667_104953745	3300025949	Corn Rhizosphere	MTDFKISGSTEQKPVNNPAPANPQQTQANPPKTDNKPSEQQK
Ga0207708_106313312	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPADKPSEQQK
Ga0256867_103454281	3300026535	Soil	MTNVNISASEPQKPANPSPATPQQQTQGNPAKPADKPGEQQK
Ga0209577_102734272	3300026552	Soil	MTNVPISASEPQKPANPAPATPQQQTQGNPNPKPVDKPSEQQK
Ga0179587_110519651	3300026557	Vadose Zone Soil	MTSIPISASEPQKPASPTPATPQQQTQANPKPADKPVQQQK
Ga0209515_100733615	3300027835	Groundwater	MTNAPVANSDPKPATPASPQQQTQGTPPKPADKPSEQQK
Ga0209488_101255212	3300027903	Vadose Zone Soil	MTNVPISASEPQKPASPAPATPQQQTQANPKPVEKPAQQQK
Ga0207428_107498953	3300027907	Populus Rhizosphere	MTNVTISASEPQKPATPAPATPQQQTQAAPKPADKPSEQQK
Ga0268264_103826151	3300028381	Switchgrass Rhizosphere	MTTVPVSAAEPQTPATPATPQQQTQGNPPKPVDKPSEQQ
Ga0308309_113965422	3300028906	Soil	ISASEPQKPADPTPAIPQQQTQSNLQKPAGKPGEQQK
Ga0308178_10959272	3300030990	Soil	MTDVKISASAEQKPANNPAPATPQQQTQANPPKPADKPSDQQK
Ga0308178_11431393	3300030990	Soil	GNTMTIINITSSNEPQKPANPAPAMPQQTQGTPSKPADKPSEQQK
Ga0170834_1128606771	3300031057	Forest Soil	MTNVTISASEPQKPTNPTPATPQQQTQDNPAKPADKPAQQQK
Ga0308181_10874441	3300031099	Soil	NVTISANEPQKPANPSQATPQQQTQGNPPKPADKPEQQK
Ga0299913_109664101	3300031229	Soil	MTNVNISASEPQKPANPSPATPQQQTQGTPAKPTDKPGEQQK
Ga0308179_10495721	3300031424	Soil	TISANEPHKPSNPSQATNQQQTQGNPPKPADKPEQQK
Ga0307505_102684622	3300031455	Soil	MTNIPVSNSTPEQKPATPAAPQQTQGNPPKPADKPNEQQK
Ga0170818_1034250491	3300031474	Forest Soil	MTTVQISASEPQKPATPATPQQQTQGNPPKPADKPSEQQK
Ga0310886_100606824	3300031562	Soil	VTIINITASNEPQKPANLAPATPQQTQGTPSKPADKPSEQQK
Ga0310813_119311722	3300031716	Soil	VLNLFIKDITVTNISITASESQKPATPSPTTPQQQTQGNPPKPADKPSEQ
Ga0326597_113825121	3300031965	Soil	MTNVVISASEPQKPANPAPATPQQQTQGNPKPAEKQGEQQK
Ga0372943_0577295_506_628	3300034268	Soil	MTNVPISASDPQKPATPATPQQQTQGNPPKPADKPSEQQK
Ga0370548_028259_25_153	3300034644	Soil	MTNVTISANEPQKPANPSQATPQQQTQGNPPKPADKPSEQQK

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.14
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.14
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters