NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103387_100229

Scaffold Ga0103387_100229


Overview

Basic Information
Taxon OID3300008874 Open in IMG/M
Scaffold IDGa0103387_100229 Open in IMG/M
Source Dataset NameMicrobial communities of Wadden Sea tidal flat in Germany - 1250 highTide
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterBielefeld University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)626
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Source Dataset Sampling Location
Location NameWadden Sea, Germany
CoordinatesLat. (o)53.73Long. (o)7.67Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060086Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0103387_1002291F060086N/AFELDSNLLLSSGRHGEDRKRQYALYVYNHETPLLDDLADLLYIYSIEYYYT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.