Basic Information | |
---|---|
Taxon OID | 3300008874 Open in IMG/M |
Scaffold ID | Ga0103387_100229 Open in IMG/M |
Source Dataset Name | Microbial communities of Wadden Sea tidal flat in Germany - 1250 highTide |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Bielefeld University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 626 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Wadden Sea, Germany | |||||||
Coordinates | Lat. (o) | 53.73 | Long. (o) | 7.67 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F060086 | Metagenome / Metatranscriptome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103387_1002291 | F060086 | N/A | FELDSNLLLSSGRHGEDRKRQYALYVYNHETPLLDDLADLLYIYSIEYYYT* |
⦗Top⦘ |