| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008874 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117938 | Gp0125976 | Ga0103387 |
| Sample Name | Microbial communities of Wadden Sea tidal flat in Germany - 1250 highTide |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Bielefeld University |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 3522341 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Wadden Sea Tidal Flat In Germany |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Wadden Sea, Germany | |||||||
| Coordinates | Lat. (o) | 53.73 | Long. (o) | 7.67 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103387_100229 | All Organisms → cellular organisms → Eukaryota | 626 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103387_100229 | Ga0103387_1002291 | F060086 | FELDSNLLLSSGRHGEDRKRQYALYVYNHETPLLDDLADLLYIYSIEYYYT* |
| ⦗Top⦘ |