NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103385_100231

Scaffold Ga0103385_100231


Overview

Basic Information
Taxon OID3300008872 Open in IMG/M
Scaffold IDGa0103385_100231 Open in IMG/M
Source Dataset NameMicrobial communities of Wadden Sea tidal flat in Germany - 0850 lateLowTide
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterBielefeld University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)730
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Source Dataset Sampling Location
Location NameWadden Sea, Germany
CoordinatesLat. (o)53.73Long. (o)7.67Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060086Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0103385_1002311F060086N/AGQEDPFELDSNLLLSSGRYGEGCKRQYIYDHETPLLIGLADLL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.