3300008872: Microbial communities of Wadden Sea tidal flat in Germany - 0850 lateLowTide

Overview

Basic Information

• IMG/M Taxon OID: 3300008872
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117938 | Gp0125974 | Ga0103385
• Sample Name: Microbial communities of Wadden Sea tidal flat in Germany - 0850 lateLowTide
• Sequencing Status: Permanent Draft
• Sequencing Center: Bielefeld University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 5886012
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Communities Of Wadden Sea Tidal Flat In Germany
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Tidal Flat → Microbial Communities Of Wadden Sea Tidal Flat In Germany

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Sediment (saline)

Location Information

• Location: Wadden Sea, Germany
• Coordinates
  • Lat. (^o): 53.73
  • Long. (^o): 7.67
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060086	Metagenome / Metatranscriptome	133	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0103385_100231	Not Available	730

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103385_100231	Ga0103385_1002311	F060086	GQEDPFELDSNLLLSSGRYGEGCKRQYIYDHETPLLIGLADLL*