| Basic Information | |
|---|---|
| Taxon OID | 3300008724 Open in IMG/M |
| Scaffold ID | Ga0103785_105520 Open in IMG/M |
| Source Dataset Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_mRNA |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Florida |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 577 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Highborne Cay, Bahamas | |||||||
| Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027186 | Metagenome / Metatranscriptome | 195 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0103785_1055202 | F027186 | N/A | MTTNSNFNFTNNTAITLELPFSEHIEELRQRIFVVF |
| ⦗Top⦘ |