| Basic Information | |
|---|---|
| Taxon OID | 3300008686 Open in IMG/M |
| Scaffold ID | Ga0104245_1002726 Open in IMG/M |
| Source Dataset Name | Food microbial communities from the fermentation process of Kimchi from South Korea - J7 |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chung-Ang Univiersity |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 653 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Hypocreomycetidae → Hypocreales → Ophiocordycipitaceae → Ophiocordyceps → Ophiocordyceps sinensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Fermented Vegetables → Food Microbial Communities From The Fermentation Process Of Kimchi From South Korea |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Korea | |||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F013050 | Metagenome / Metatranscriptome | 275 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104245_10027262 | F013050 | AGG | MSKGKQPRTRVKVPKLLLSENKEVFFKYNQEIGLEAAIF* |
| ⦗Top⦘ |