NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103623_1004066

Scaffold Ga0103623_1004066


Overview

Basic Information
Taxon OID3300008651 Open in IMG/M
Scaffold IDGa0103623_1004066 Open in IMG/M
Source Dataset NameMicrobial communities of saline water collected from the North Sea in Germany - HE327_13
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterGoettingen Genomics Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)874
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → unclassified Cellvibrionales → Cellvibrionales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → North Sea → Microbial Communities Of Saline Water Collected From The North Sea In Germany

Source Dataset Sampling Location
Location NameNorth Sea, Germany
CoordinatesLat. (o)54.4365Long. (o)8.2328Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054345Metagenome / Metatranscriptome140Y
F059341Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0103623_10040661F054345N/AVFLYSGFLVYFFDFSIKTVGGGPTCQSLFFACAKKSNQKKAHNLTKIDPDITYSLWDGFIQYTLATPTKTFFTRLSWSSISELASSQYHSDSADFSKHNEATTNKFSRLLFILEQVKTVPNGRLLLLSSACRSKKIVEEPSREKIAMKSSSSKE*
Ga0103623_10040662F059341N/AMLDVSAAQKKYPLYRLAIISLELLDRKHCEMHPSWLSFAVKLTAFLVTF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.