Scaffold Ga0103784_1005942

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103784_1005942

Scaffold Ga0103784_1005942

Overview

Basic Information
Taxon OID	3300008568 Open in IMG/M
Scaffold ID	Ga0103784_1005942 Open in IMG/M
Source Dataset Name	Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_total_RNA
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Florida
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	531
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas

Source Dataset Sampling Location
Location Name	Highborne Cay, Bahamas
Coordinates	Lat. (^o)	24.72	Long. (^o)	-76.82	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060086	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103784_10059421	F060086	N/A	NLLLSSGQHGEDRKRQYFLYDHETPLLADLADLLYIKYGIAFLVLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.