| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300008568 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117975 | Gp0126373 | Ga0103784 |
| Sample Name | Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_total_RNA |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Florida |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 25947518 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → cay → microbial mat material |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Surface (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Highborne Cay, Bahamas | |||||||
| Coordinates | Lat. (o) | 24.72 | Long. (o) | -76.82 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F015563 | Metagenome / Metatranscriptome | 253 | Y |
| F047147 | Metagenome / Metatranscriptome | 150 | Y |
| F060086 | Metagenome / Metatranscriptome | 133 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0103784_1001629 | Not Available | 951 | Open in IMG/M |
| Ga0103784_1003740 | All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera | 655 | Open in IMG/M |
| Ga0103784_1005942 | Not Available | 531 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0103784_1001629 | Ga0103784_10016291 | F047147 | MFLITFILAVTEGLVREEQLLHDLCLLGAVNAEIIQILTRAGLF* |
| Ga0103784_1003740 | Ga0103784_10037401 | F015563 | QGLKPAFWGKWGALNPKHAEKYIKMAYNRGYGQPLLTSKVYHADEPTTWLTFFARRYQYDWLKHIAMRVDAQRVPLYVLRRQLWMARFEYYMRRFQTRKAISNAAKVEWAYIKERIAQPFTWTGRDAQHFFFWLLNVAAFFAIGEVIARQNIYGYPVATPEWTPSKPKFAPGFYHTYYPFEDYPFENNPNMITKQFNRSSWWHNTNETYWAPHRVLAT |
| Ga0103784_1005942 | Ga0103784_10059421 | F060086 | NLLLSSGQHGEDRKRQYFLYDHETPLLADLADLLYIKYGIAFLVLF* |
| ⦗Top⦘ |