NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008568

3300008568: Microbial communities of thrombolites from Highborne Cay, Bahamas - Zone1_total_RNA



Overview

Basic Information
IMG/M Taxon OID3300008568 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117975 | Gp0126373 | Ga0103784
Sample NameMicrobial communities of thrombolites from Highborne Cay, Bahamas - Zone1_total_RNA
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Florida
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25947518
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities Of Thrombolites From Highborne Cay, Bahamas
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Microbial Mats → Microbial Mats → Microbial Communities Of Thrombolites From Highborne Cay, Bahamas

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomecaymicrobial mat material
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Surface (saline)

Location Information
LocationHighborne Cay, Bahamas
CoordinatesLat. (o)24.72Long. (o)-76.82Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015563Metagenome / Metatranscriptome253Y
F047147Metagenome / Metatranscriptome150Y
F060086Metagenome / Metatranscriptome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103784_1001629Not Available951Open in IMG/M
Ga0103784_1003740All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera655Open in IMG/M
Ga0103784_1005942Not Available531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103784_1001629Ga0103784_10016291F047147MFLITFILAVTEGLVREEQLLHDLCLLGAVNAEIIQILTRAGLF*
Ga0103784_1003740Ga0103784_10037401F015563QGLKPAFWGKWGALNPKHAEKYIKMAYNRGYGQPLLTSKVYHADEPTTWLTFFARRYQYDWLKHIAMRVDAQRVPLYVLRRQLWMARFEYYMRRFQTRKAISNAAKVEWAYIKERIAQPFTWTGRDAQHFFFWLLNVAAFFAIGEVIARQNIYGYPVATPEWTPSKPKFAPGFYHTYYPFEDYPFENNPNMITKQFNRSSWWHNTNETYWAPHRVLAT
Ga0103784_1005942Ga0103784_10059421F060086NLLLSSGQHGEDRKRQYFLYDHETPLLADLADLLYIKYGIAFLVLF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.