| Basic Information | |
|---|---|
| Taxon OID | 3300008409 Open in IMG/M |
| Scaffold ID | Ga0114885_10813 Open in IMG/M |
| Source Dataset Name | Coastal sediment microbial communities from intertidal sand flat, Janssand, Germany_1868_binC |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Plant Breeding Research |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 85567 |
| Total Scaffold Genes | 68 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 36 (52.94%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Coastal → Sediment → Sediment → Coastal Sediment Microbial Communities From Intertidal Sand Flat, Janssand, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Janssand, Germany | |||||||
| Coordinates | Lat. (o) | 53.736 | Long. (o) | 7.6989 | Alt. (m) | Depth (m) | .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F059980 | Metagenome / Metatranscriptome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0114885_1081349 | F059980 | N/A | MEEAFLMGFSGGFEQGKPATALPELINFISINIERVNP* |
| ⦗Top⦘ |