| Basic Information | |
|---|---|
| Taxon OID | 3300008158 Open in IMG/M |
| Scaffold ID | Ga0100217_10042 Open in IMG/M |
| Source Dataset Name | Minidiscus trioculatus and Planctomycetes bacterium Co-assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 40543 |
| Total Scaffold Genes | 85 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 9 (10.59%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Eukaryotic Communities From Various Locations To Study Complex Ecological Interactions |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Monterey Bay | |||||||
| Coordinates | Lat. (o) | 36.746 | Long. (o) | -122.026 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F080094 | Metagenome / Metatranscriptome | 115 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0100217_1004261 | F080094 | N/A | MKKQTQKDKKVRKLFNQNEVNNIILKSIVKNENLSLIVK* |
| ⦗Top⦘ |