NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F080094

Metagenome / Metatranscriptome Family F080094

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F080094
Family Type Metagenome / Metatranscriptome
Number of Sequences 115
Average Sequence Length 42 residues
Representative Sequence MKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK
Number of Associated Samples 97
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 1.74 %
% of genes near scaffold ends (potentially truncated) 46.09 %
% of genes from short scaffolds (< 2000 bps) 78.26 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (62.609 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(26.087 % of family members)
Environment Ontology (ENVO) Unclassified
(35.652 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(73.913 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.78%    β-sheet: 0.00%    Coil/Unstructured: 55.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00329Complex1_30kDa 64.35
PF00507Oxidored_q4 16.52
PF00346Complex1_49kDa 7.83
PF10588NADH-G_4Fe-4S_3 1.74
PF00253Ribosomal_S14 1.74
PF00384Molybdopterin 0.87
PF00420Oxidored_q2 0.87
PF06455NADH5_C 0.87
PF00115COX1 0.87
PF00119ATP-synt_A 0.87

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 115 Family Scaffolds
COG0852NADH:ubiquinone oxidoreductase 27 kD subunit (chain C)Energy production and conversion [C] 64.35
COG3262Ni,Fe-hydrogenase III component GEnergy production and conversion [C] 64.35
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 16.52
COG0649NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)Energy production and conversion [C] 7.83
COG3261Ni,Fe-hydrogenase III large subunitEnergy production and conversion [C] 7.83
COG0199Ribosomal protein S14Translation, ribosomal structure and biogenesis [J] 1.74
COG1009Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunitEnergy production and conversion [C] 1.74
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 0.87

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.61 %
UnclassifiedrootN/A17.39 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000120|SA_S2_NOR13_50mDRAFT_c1002566All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3870Open in IMG/M
3300000792|BS_KBA_SWE02_21mDRAFT_10018040All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2292Open in IMG/M
3300003682|Ga0008456_1048026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria734Open in IMG/M
3300003712|Ga0008276_103164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria780Open in IMG/M
3300004097|Ga0055584_100470093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1306Open in IMG/M
3300005565|Ga0068885_1827836All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300006378|Ga0075498_1290212All Organisms → cellular organisms → Eukaryota913Open in IMG/M
3300006379|Ga0075513_1354672All Organisms → cellular organisms → Eukaryota → Sar820Open in IMG/M
3300006383|Ga0075504_1013030All Organisms → cellular organisms → Eukaryota → Sar707Open in IMG/M
3300006383|Ga0075504_1039532All Organisms → cellular organisms → Eukaryota992Open in IMG/M
3300006383|Ga0075504_1365081Not Available581Open in IMG/M
3300006383|Ga0075504_1407413All Organisms → cellular organisms → Eukaryota1132Open in IMG/M
3300006384|Ga0075516_1391357All Organisms → cellular organisms → Eukaryota756Open in IMG/M
3300006393|Ga0075517_1577728All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica914Open in IMG/M
3300006396|Ga0075493_1560574All Organisms → cellular organisms → Eukaryota → Sar858Open in IMG/M
3300006403|Ga0075514_1823455All Organisms → cellular organisms → Eukaryota741Open in IMG/M
3300006571|Ga0075505_1008741All Organisms → cellular organisms → Eukaryota857Open in IMG/M
3300006641|Ga0075471_10045332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2468Open in IMG/M
3300006874|Ga0075475_10280630All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica692Open in IMG/M
3300006874|Ga0075475_10322248All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta634Open in IMG/M
3300007552|Ga0102818_1034692All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta997Open in IMG/M
3300007552|Ga0102818_1077881All Organisms → cellular organisms → Eukaryota654Open in IMG/M
3300007555|Ga0102817_1004026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3535Open in IMG/M
3300007559|Ga0102828_1157996Not Available571Open in IMG/M
3300007561|Ga0102914_1290444Not Available500Open in IMG/M
3300007636|Ga0102856_1050640All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta656Open in IMG/M
3300007661|Ga0102866_1082468All Organisms → cellular organisms → Eukaryota794Open in IMG/M
3300007681|Ga0102824_1043334All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1191Open in IMG/M
3300007715|Ga0102827_1016933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1643Open in IMG/M
3300007864|Ga0105749_1175052All Organisms → cellular organisms → Eukaryota516Open in IMG/M
3300007955|Ga0105740_1009584All Organisms → cellular organisms → Eukaryota1219Open in IMG/M
3300008116|Ga0114350_1097772All Organisms → cellular organisms → Eukaryota934Open in IMG/M
3300008158|Ga0100217_10042All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta40543Open in IMG/M
3300008958|Ga0104259_1037145Not Available519Open in IMG/M
3300008995|Ga0102888_1001144All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5582Open in IMG/M
3300009000|Ga0102960_1106308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1021Open in IMG/M
3300009002|Ga0102810_1257819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria538Open in IMG/M
3300009003|Ga0102813_1198457All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta621Open in IMG/M
3300009027|Ga0102957_1132812All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta878Open in IMG/M
3300009054|Ga0102826_1022470All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1593Open in IMG/M
3300009055|Ga0102905_1003453All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2756Open in IMG/M
3300009130|Ga0118729_1000783All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta41923Open in IMG/M
3300009235|Ga0103857_10001483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2788Open in IMG/M
3300009243|Ga0103860_10074875All Organisms → cellular organisms → Eukaryota704Open in IMG/M
3300009402|Ga0103742_1048195Not Available554Open in IMG/M
3300009436|Ga0115008_10007965All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta8724Open in IMG/M
3300009543|Ga0115099_10187216All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4089Open in IMG/M
3300009543|Ga0115099_10371472All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1289Open in IMG/M
3300009543|Ga0115099_10541409Not Available3736Open in IMG/M
3300009543|Ga0115099_10614735Not Available503Open in IMG/M
3300009543|Ga0115099_10689389All Organisms → cellular organisms → Eukaryota867Open in IMG/M
3300009543|Ga0115099_10854435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria846Open in IMG/M
3300009592|Ga0115101_1048935All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica1436Open in IMG/M
3300009592|Ga0115101_1522295All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria591Open in IMG/M
3300009592|Ga0115101_1649479All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica834Open in IMG/M
3300010305|Ga0129320_102116All Organisms → cellular organisms → Eukaryota688Open in IMG/M
3300010404|Ga0129323_1089918All Organisms → cellular organisms → Eukaryota708Open in IMG/M
3300010997|Ga0139324_1120964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria676Open in IMG/M
3300012408|Ga0138265_1008575All Organisms → cellular organisms → Eukaryota859Open in IMG/M
3300012408|Ga0138265_1121836All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta5630Open in IMG/M
3300012523|Ga0129350_1441914All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria710Open in IMG/M
3300012935|Ga0138257_1517118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria816Open in IMG/M
3300018636|Ga0193377_1008903All Organisms → cellular organisms → Eukaryota813Open in IMG/M
3300019009|Ga0192880_10100798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria735Open in IMG/M
3300019021|Ga0192982_10006645Not Available2147Open in IMG/M
3300019022|Ga0192951_10003950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2150Open in IMG/M
3300019022|Ga0192951_10119236All Organisms → cellular organisms → Eukaryota894Open in IMG/M
3300019198|Ga0180033_116870All Organisms → cellular organisms → Eukaryota → Sar767Open in IMG/M
3300019200|Ga0180036_1055202Not Available528Open in IMG/M
3300019207|Ga0180034_1033869All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta733Open in IMG/M
3300019214|Ga0180037_1062854Not Available1399Open in IMG/M
3300019214|Ga0180037_1080737All Organisms → cellular organisms → Eukaryota → Sar590Open in IMG/M
3300019214|Ga0180037_1130912All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1350Open in IMG/M
3300019700|Ga0194006_1013076All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta840Open in IMG/M
3300019715|Ga0193966_1014266Not Available819Open in IMG/M
3300019718|Ga0193999_1000953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2110Open in IMG/M
3300019718|Ga0193999_1019145All Organisms → cellular organisms → Eukaryota753Open in IMG/M
3300019724|Ga0194003_1000129All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta4169Open in IMG/M
3300019733|Ga0194013_1003794Not Available1239Open in IMG/M
3300019734|Ga0193970_1005331Not Available1281Open in IMG/M
3300019747|Ga0193978_1000582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2600Open in IMG/M
3300019753|Ga0194010_1095541Not Available549Open in IMG/M
3300020074|Ga0194113_10275429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1292Open in IMG/M
3300021091|Ga0194133_10374480All Organisms → cellular organisms → Eukaryota807Open in IMG/M
3300021093|Ga0194123_10185570Not Available1080Open in IMG/M
3300021345|Ga0206688_10314517All Organisms → cellular organisms → Eukaryota686Open in IMG/M
3300021347|Ga0213862_10024460All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2242Open in IMG/M
3300021373|Ga0213865_10088104All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1671Open in IMG/M
3300021376|Ga0194130_10048601All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta3062Open in IMG/M
3300021378|Ga0213861_10062113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2349Open in IMG/M
3300021849|Ga0210304_1036828All Organisms → cellular organisms → Eukaryota701Open in IMG/M
3300021960|Ga0222715_10282723All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta950Open in IMG/M
3300021961|Ga0222714_10384815Not Available745Open in IMG/M
3300022374|Ga0210311_1018075All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica849Open in IMG/M
(restricted) 3300023085|Ga0233406_10000031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta8023Open in IMG/M
(restricted) 3300023210|Ga0233412_10347396All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta660Open in IMG/M
3300024346|Ga0244775_10077510All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta2844Open in IMG/M
3300024547|Ga0255292_1099424Not Available571Open in IMG/M
3300025840|Ga0208917_1047567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1708Open in IMG/M
3300027195|Ga0208676_1001412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2223Open in IMG/M
3300027236|Ga0208026_1024380All Organisms → cellular organisms → Eukaryota870Open in IMG/M
3300027243|Ga0208174_1017253All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta911Open in IMG/M
3300027254|Ga0208177_1096938Not Available536Open in IMG/M
3300027393|Ga0209867_1062659All Organisms → cellular organisms → Eukaryota563Open in IMG/M
3300027506|Ga0208973_1099754All Organisms → cellular organisms → Eukaryota657Open in IMG/M
3300027525|Ga0208437_1046562All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica1049Open in IMG/M
3300027525|Ga0208437_1079607All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta764Open in IMG/M
3300027751|Ga0208304_10198984All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → unclassified Bacillariophycidae → Endosymbiont of Durinskia baltica723Open in IMG/M
3300027836|Ga0209230_10182166Not Available1204Open in IMG/M
3300028524|Ga0210314_112957All Organisms → cellular organisms → Eukaryota731Open in IMG/M
3300031589|Ga0307996_1000026All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta40470Open in IMG/M
3300031658|Ga0307984_1029288All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1813Open in IMG/M
3300033995|Ga0335003_0289521All Organisms → cellular organisms → Eukaryota740Open in IMG/M
3300034019|Ga0334998_0225550All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1150Open in IMG/M
3300034107|Ga0335037_0661342Not Available547Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine26.09%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous15.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.04%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment7.83%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.61%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.61%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.61%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water1.74%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.74%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.74%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.74%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.74%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.74%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.74%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water1.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.87%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.87%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.87%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.87%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.87%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.87%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.87%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.87%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.87%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.87%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.87%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000120Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 13_50mEnvironmentalOpen in IMG/M
3300000792Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21mEnvironmentalOpen in IMG/M
3300003682Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_03_M0_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003712Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005565Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006379Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006571Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007636Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3EnvironmentalOpen in IMG/M
3300007661Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007715Estuarine microbial communities from the Columbia River estuary - metaG S.751EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008158Minidiscus trioculatus and Planctomycetes bacterium Co-assemblyEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008995Estuarine microbial communities from the Columbia River estuary - metaG 1551A-3EnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009054Estuarine microbial communities from the Columbia River estuary - metaG S.737EnvironmentalOpen in IMG/M
3300009055Estuarine microbial communities from the Columbia River estuary - metaG 1556B-3EnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009235Microbial communities of water from Amazon river, Brazil - RCM10EnvironmentalOpen in IMG/M
3300009243Microbial communities of water from Amazon river, Brazil - RCM13EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010305Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018636Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001943 (ERX1782245-ERR1711897)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019198Estuarine microbial communities from the Columbia River estuary - R8.48AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019700Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_2-3_MGEnvironmentalOpen in IMG/M
3300019715Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_2-3_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019724Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_9-10_MGEnvironmentalOpen in IMG/M
3300019733Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_9-10_MGEnvironmentalOpen in IMG/M
3300019734Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_6-7_MGEnvironmentalOpen in IMG/M
3300019747Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MGEnvironmentalOpen in IMG/M
3300019753Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_6-7_MGEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021376Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surfaceEnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024547Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027195Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027236Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027393Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028524Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S2_NOR13_50mDRAFT_100256643300000120MarineMKKQTQKDKKLRKLFNQQELNNIILKSIVKNENLSLIVK*
BS_KBA_SWE02_21mDRAFT_1001804053300000792MarineMKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITK*
Ga0008456_104802633300003682SeawaterMKKKLQKDIKLRKLFNQQELNHIILKSIVKNENLSLILKWNAVSKLSNFLGGQNK
Ga0008276_10316433300003712MarineMKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSLLIK*
Ga0055584_10047009313300004097Pelagic MarineMKKQIKKDKNIRKLFAQQELDNIILKSIIKNENLSLIVK*
Ga0068885_182783613300005565Freshwater LakeMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLVKWNAVLKLSNFL
Ga0075498_129021223300006378AqueousMKKQTQKDKQIRKLFNKRELNYVILKSIIKNENLSLIIK*
Ga0075513_135467223300006379AqueousMKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK*
Ga0075504_101303023300006383AqueousMKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK*NAVSKLA
Ga0075504_103953223300006383AqueousMKKQIKKDKTIRKLFAQQEVDNIILKSIIKNENLSLIVK*
Ga0075504_136508123300006383AqueousMKKQLQKDKKIRKLYNQHELNHVILKSIIKNENLSLIIK*
Ga0075504_140741333300006383AqueousLIILLFLRYMKKQTQKDKKIRRLFNQQELNYVILKSIIKNENLSLIIK*
Ga0075516_139135723300006384AqueousMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK*
Ga0075517_157772823300006393AqueousMKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITK*
Ga0075493_156057423300006396AqueousMKKQTQKDKRIRKLFNQREVSQVILKSIIKNENLSLNVK*
Ga0075514_182345513300006403AqueousMKKKLQKDIKLRKLFNQQELNHIILKSIVKNENLSLILKWNAVSKLSNFLGGQNKTRF
Ga0075505_100874123300006571AqueousMKKHIQKDRKLRKFFDREELSYIVLKSIVKNENLSLTIK*
Ga0075471_1004533273300006641AqueousQKDKQIRKLFNKRELNYVILKSIIKNENLSLIIK*
Ga0075475_1028063013300006874AqueousMKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITK*NAILKLSS
Ga0075475_1032224833300006874AqueousMKKQTQKDKKIRRLFNQQELNYVILKSIIKNENLSLIIK*
Ga0102818_103469213300007552EstuarineICMKKKTQKDKKIRKLFIRQELKYVILKSIVKNENLSLTVK*
Ga0102818_107788113300007552EstuarineMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIKWNAILKLSKFSG
Ga0102817_100402623300007555EstuarineMKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVK*
Ga0102828_115799613300007559EstuarineMKKQTQKDKKLRKSFNQQELNNVILKSIVKNENLSLLIK*
Ga0102914_129044433300007561EstuarineMKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKW
Ga0102856_105064013300007636EstuarineFMKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITK*
Ga0102866_108246823300007661EstuarineMKKQTQKDKKIRKLFNQQELNYVILKSIVKNENLSLITKWNAISKLSHFSRNHN
Ga0102824_104333423300007681EstuarineMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIK*
Ga0102827_101693333300007715EstuarineMKKKLQKDIKIRKLFNQKELNHTILKSIVKNENLSLITK*
Ga0105749_117505223300007864Estuary WaterMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAI
Ga0105740_100958433300007955Estuary WaterMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLVKWNAVLKLSNFLGS
Ga0114350_109777223300008116Freshwater, PlanktonMKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAV
Ga0100217_10042613300008158MarineMKKQTQKDKKVRKLFNQNEVNNIILKSIVKNENLSLIVK*
Ga0104259_103714523300008958Ocean WaterMKKQTQKDKRIRKLFNKRELNYVILKSIVKNENLSLIVK*
Ga0102888_100114443300008995EstuarineMKKQTQKDKRIRKMFNQQEVSQVILKSIIKNENLSLNVK*
Ga0102960_110630823300009000Pond WaterLINGMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK*
Ga0102810_125781913300009002EstuarineMKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIK
Ga0102813_119845713300009003EstuarineICMKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK*
Ga0102957_113281233300009027Pond WaterMKKQTQKDKRIRKLFNRRELNYIILKSIVKNENLSLITK*
Ga0102826_102247063300009054EstuarineQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK*
Ga0102905_100345343300009055EstuarineMKKKNQKDKKIRKLFNQREIKYVILKSIIKNENLSLIVK*
Ga0118729_1000783233300009130MarineMKKKLPKDIKIRKFFNQQELNYIILKSVVKNENLPLMVK*
Ga0103857_1000148333300009235River WaterMKKQTQKDKKCRKSFNQQELNQVILKSIVKNENLSLLIK*
Ga0103860_1007487513300009243River WaterMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAISRLSTFAGNQNK
Ga0103742_104819523300009402Ice Edge, Mcmurdo Sound, AntarcticaMKKKLQKDKKIRKLFNRRELNHVILKSIVKNENLSLIAQT
Ga0115008_1000796553300009436MarineMKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK*
Ga0115099_1018721633300009543MarineMKKKFQKDIKIRKFLNQQELNHIILKSIVKNENLSLIVK*
Ga0115099_1037147223300009543MarineMKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK*
Ga0115099_1054140983300009543MarineMQKQIQKDRKIRKIFNKQELNYSILKSMVKNENLSLIIK*
Ga0115099_1061473523300009543MarineMQKKSQKDKKIRKLFYRQELIQIFTKSIIRNENLSLIVK*
Ga0115099_1068938923300009543MarineMKKKSQKDKKIRKLFNQQELSQIILKSVIRNENVSLLVK*
Ga0115099_1085443533300009543MarineMKKQLQKDKKIRTLFSQQEINWIIFKSIVKNENLPLMVK*
Ga0115101_104893543300009592MarineMKKQIKKDKNIRRLFAQQELDNIILKSIIKNENLSLIVK*
Ga0115101_152229513300009592MarineMQKKSQKDKKIRKLFYRQELIQIFTKSIIRNENLSLIVK*KAILKLSNFS
Ga0115101_164947923300009592MarineMKKLFQKDKKIRKLFNQQELDYIVLKNIVKNENLSLVVK*
Ga0129320_10211623300010305AqueousMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLK*
Ga0129323_108991833300010404AqueousMKKKTQKDKRIRKLFNKRELNYVILKSIVKNENLSLITK*NAILKLSN
Ga0139324_112096433300010997SedimentMKKQIQKDKLIRKLFNKRELNHIILKSIVKNENLPLVTK*
Ga0138265_100857523300012408Polar MarineMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK*
Ga0138265_112183673300012408Polar MarineMKKQTQKDKKLRKLFNQQELNHTILKSIAKNENLSLIVK*
Ga0129350_144191413300012523AqueousMKKQTQKDKRIRKLFNKRELNHIILKSIVKNENLPLVTK*
Ga0138257_151711813300012935Polar MarineMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVKKRSF*
Ga0193377_100890313300018636MarineMKKQFQKDKKLRKLFNQKELSTFLLKSIVRNSNLSVITKXNAILKLSDA
Ga0192880_1010079813300019009MarineMKKQTQKDKRIRKLFNQQELNYVILKSIVKNENLSLIVK
Ga0192982_1000664543300019021MarineMKKQFQKDKKLRKLFDKKELTNLILKNIVRNSNLSLIVKXNAILKLSNLSKHY
Ga0192951_1000395063300019022MarineMKKKSQKDKKTRKSFNQQELTQTIIKSIIRNENLSSIVKWNAISKLSNLP
Ga0192951_1011923623300019022MarineMKKKSQKDKKTRKFFNQQELTQIILKSIIRNENLSSIVK
Ga0180033_11687023300019198EstuarineMKKQTQKDKRIRKMFNQQEVSQVILKSIIKNENLSLNVK
Ga0180036_105520213300019200EstuarineMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSL
Ga0180034_103386923300019207EstuarineMKKQTQKDKKLRKSFNQQELNNVILKSIVKNENLSLLIK
Ga0180037_106285443300019214EstuarineMKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSL
Ga0180037_108073723300019214EstuarineMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK
Ga0180037_113091223300019214EstuarineMKKKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK
Ga0194006_101307623300019700SedimentNCLNICMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK
Ga0193966_101426613300019715SedimentMKKQTQKDKKIRRLFNQQELKHIILKNIVKNENLSLNVKWNAISKLSNFSLSHKKTRFVN
Ga0193999_100095333300019718SedimentMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK
Ga0193999_101914513300019718SedimentMKKHTQKDKKIRKRFNQQEMSSIILKSIVKNENFSLIVK
Ga0194003_100012913300019724SedimentISLINDMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK
Ga0194013_100379433300019733SedimentMKKQTQKDKRIRKLFNRRELNYIILKSIIKNENLSLITKXNA
Ga0193970_100533153300019734SedimentMKKQTQKDKKIRRLFNQQELKHIILKSIVKNENLSLNVKWNAISKLSNFSLSHKKTRFVN
Ga0193978_100058223300019747SedimentLINDLKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK
Ga0194010_109554123300019753SedimentMKKQIKKDKNSRKLFAQQELDNIILKSIIKNENLSLIVK
Ga0194113_1027542933300020074Freshwater LakeMKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIK
Ga0194133_1037448033300021091Freshwater LakeMKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIKXNAV
Ga0194123_1018557043300021093Freshwater LakeMKKQTQKDRKLRKSFNQQELNNVILKSIVKNENLSLLIKXNAVLKLSK
Ga0206688_1031451723300021345SeawaterMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVKXNAVSK
Ga0213862_1002446013300021347SeawaterINDMKKHTQKDKKIRKRFNQQEVSSIILKSIVKNENFSLIVK
Ga0213865_1008810473300021373SeawaterMKKQIQKDKQIRKLFNKRELNYTILKSIVKNENLSLVIK
Ga0194130_1004860133300021376Freshwater LakeMKKQTQKDRKLRKSFNQQELNNLILKSIVKNENLSLLIK
Ga0213861_1006211343300021378SeawaterMKKQTQKDKRIRKLFNKRELNYVILKSIVKNENLSLITK
Ga0210304_103682833300021849EstuarineMKKQTQKDKNLRKSFNRQELNYLILKSIVKNENLSLLIKWNAILKLSNYL
Ga0222715_1028272323300021960Estuarine WaterMKKQKQRDKKIRKLFNQQELNQVILKSIVKNENLSLLVK
Ga0222714_1038481513300021961Estuarine WaterMKKQFQKDKKIRNHYFQQELNNIVLKSIVRNENIPLLVK
Ga0210311_101807523300022374EstuarineMKKIFQKDKKIRKLFNQQELDYIVLKNIVKNENLSLVVK
(restricted) Ga0233406_1000003133300023085SeawaterMKKQIQRDKRIRKLFNKRELNRIILKSIVKNENLSLLIK
(restricted) Ga0233412_1034739623300023210SeawaterGMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSLIVK
Ga0244775_1007751013300024346EstuarineMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIK
Ga0255292_109942413300024547FreshwaterMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLSLLIKXNAVLKLSKFSGSQN
Ga0208917_104756723300025840AqueousMKKQTQKDKNIRKIFNKQELDFILLKSIIKNENLSLITK
Ga0208676_100141243300027195EstuarineMKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVK
Ga0208026_102438013300027236EstuarineMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWN
Ga0208174_101725313300027243EstuarineSVCMKKKNQKDKKIRKLFNQREIKYVILKSIIKNENLSLIVK
Ga0208177_109693823300027254EstuarineMKKQTQKDKQIRKLFNKQELNYVILKSIVKNENLSLITKXNAILKLSNLSGSH
Ga0209867_106265923300027393SandMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKW
Ga0208973_109975413300027506MarineMKKQTQKDKKIRQLFNQQEISSIILKSIVKNENLSL
Ga0208437_104656213300027525EstuarineMKKQTQKDKKIRKFFNQQELNHIILKSIVKNENLSLVLKWNAISKLS
Ga0208437_107960723300027525EstuarineKTQKDKKIRKLFNRQELKYVILKSIVKNENLSLTVK
Ga0208304_1019898423300027751EstuarineMKKKNQKDKKIRKLFNQQEIKYVILKSIIKNENLSLIVKXNAI
Ga0209230_1018216613300027836Freshwater And SedimentMKKQTQRDKKLRKFFNQQELSHFILKSIVKNENLSLLVKWNAILKLSNFLGSRSK
Ga0210314_11295723300028524EstuarineMKKQTQKDKKLRKSFNQQELNHVILKSIVKNENLS
Ga0307996_1000026543300031589MarineMKKQTQKDKKLRKLFNQQELNHTILKSIAKNENLSLIVK
Ga0307984_102928863300031658MarineMKKNSQKDKKIRKLYNQQELNYIVLKSIVKNENLSLVVK
Ga0335003_0289521_594_7403300033995FreshwaterMKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAVLKLSNF
Ga0334998_0225550_327_4463300034019FreshwaterMKKQTQKDKKIRKLYNQQELNHIILKSIVKNENLSLVLK
Ga0335037_0661342_396_5453300034107FreshwaterMKKQTQKDKNLRKSFNRQELNYIILKSIVKNENLSLLIKWNAVLKLSNFL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.