Scaffold Ga0110927_1004208

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0110927_1004208

Scaffold Ga0110927_1004208

Overview

Basic Information
Taxon OID	3300008066 Open in IMG/M
Scaffold ID	Ga0110927_1004208 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from catchments in Singapore - Site BH
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Singapore Centre on Environmental Life Sciences Engineering (SCELSE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	607
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities From Catchments In Singapore

Source Dataset Sampling Location
Location Name	Singapore
Coordinates	Lat. (^o)	1.3	Long. (^o)	103.8	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080911	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0110927_10042082	F080911	AGAAG	MPNSHQSDFKRNLRREIAGYFIVVLCALPIRFWIMATLMDQEGRWAFLASRVFGYLSVGLITAVAVSKLRLRTKLILTFLLVAL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.