| Basic Information | |
|---|---|
| Taxon OID | 3300007643 Open in IMG/M |
| Scaffold ID | Ga0104854_11200687 Open in IMG/M |
| Source Dataset Name | Biofilm microbial communities from a marine aquaculture plant in North Sea, Germany |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Max Planck Institute for Evolutionary Biology |
| Sequencing Status | Finished |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 665 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant → Biofilm Microbial Communities From A Marine Aquaculture Plant In North Sea, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Northern Germany | |||||||
| Coordinates | Lat. (o) | 54.13 | Long. (o) | 8.8 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041945 | Metagenome / Metatranscriptome | 159 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0104854_112006871 | F041945 | N/A | SPERMYREIKRLQEENRYLMRQREILKKAMSILGESPQTNMR* |
| ⦗Top⦘ |