Scaffold Ga0104349_1007519

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0104349_1007519

Scaffold Ga0104349_1007519

Overview

Basic Information
Taxon OID	3300007281 Open in IMG/M
Scaffold ID	Ga0104349_1007519 Open in IMG/M
Source Dataset Name	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Xcelris labs Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	543
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process → Activated Sludge Process Metagenomes

Source Dataset Sampling Location
Location Name	Nagpur, India
Coordinates	Lat. (^o)	21.1458004	Long. (^o)	79.0881546	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064484	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104349_10075192	F064484	GAG	VSAIVVEGASKHWTTGDGKVRAVDRLSFSLDAGTLNVLLGPSGC

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.