Metagenome / Metatranscriptome Family F064484

Basic Information
Family ID	F064484
Family Type	Metagenome / Metatranscriptome
Number of Sequences	128
Average Sequence Length	39 residues
Representative Sequence	VSAIAAENVSKHWTTADGEVRAVDGLSFAFDEGTLNVLL
Number of Associated Samples	112
Number of Associated Scaffolds	128

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	73.44 %
% of genes near scaffold ends (potentially truncated)	98.44 %
% of genes from short scaffolds (< 2000 bps)	89.06 %
Associated GOLD sequencing projects	106
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.51

Most Common Taxonomy
Group	Bacteria (52.344 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (8.594 % of family members)
Environment Ontology (ENVO)	Unclassified (35.938 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (45.312 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 32.84% Coil/Unstructured: 67.16%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 128 Family Scaffolds
PF00218	IGPS	78.91
PF00591	Glycos_transf_3	4.69
PF02885	Glycos_trans_3N	1.56
PF00117	GATase	1.56
PF00583	Acetyltransf_1	1.56
PF00425	Chorismate_bind	0.78
PF07043	DUF1328	0.78
PF13540	RCC1_2	0.78
PF00903	Glyoxalase	0.78

COG ID	Name	Functional Category	% Frequency in 128 Family Scaffolds
COG0134	Indole-3-glycerol phosphate synthase	Amino acid transport and metabolism [E]	78.91
COG5487	Uncharacterized membrane protein YtjA, UPF0391 family	Function unknown [S]	0.78

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	55.47 %
Unclassified	root	N/A	44.53 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	55.47 %
Unclassified	root	N/A	44.53 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	52.34 %
Unclassified	root	N/A	44.53 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	42.19 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.12 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	22.66 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.12 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.56 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	7.03 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.12 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1.56 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	1.56 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Comamonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae	3.12 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.12 %
Azonexaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	3.12 %
Hydrogenophaga	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga	2.34 %
Dechloromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	3.12 %
unclassified Hydrogenophaga	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga	2.34 %
unclassified Dechloromonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
unclassified Acidovorax	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	44.53 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	3.12 %
Hydrogenophaga sp. T4	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	2.34 %
Dechloromonas sp. HYN0024	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	1.56 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1.56 %
Acidovorax sp. Root219	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	0.78 %
Chromatiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	0.78 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300004058\|Ga0055498_10043595	All Organisms → cellular organisms → Bacteria → Proteobacteria	769	Open in IMG/M
3300004082\|Ga0062384_100040404	All Organisms → cellular organisms → Bacteria → Proteobacteria	2185	Open in IMG/M
3300004635\|Ga0062388_101686681	All Organisms → cellular organisms → Bacteria → Proteobacteria	647	Open in IMG/M
3300005328\|Ga0070676_10221872	All Organisms → cellular organisms → Bacteria	1249	Open in IMG/M
3300005329\|Ga0070683_101079538	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300005345\|Ga0070692_10119148	All Organisms → cellular organisms → Bacteria → Proteobacteria	1470	Open in IMG/M
3300005364\|Ga0070673_102315207	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300005439\|Ga0070711_101627282	All Organisms → cellular organisms → Bacteria → Proteobacteria	565	Open in IMG/M
3300005440\|Ga0070705_101746360	All Organisms → cellular organisms → Bacteria → Proteobacteria	527	Open in IMG/M
3300005457\|Ga0070662_101775725	All Organisms → cellular organisms → Bacteria → Proteobacteria	533	Open in IMG/M
3300005518\|Ga0070699_100140469	All Organisms → cellular organisms → Bacteria → Proteobacteria	2132	Open in IMG/M
3300005518\|Ga0070699_100442103	All Organisms → cellular organisms → Bacteria → Proteobacteria	1178	Open in IMG/M
3300005530\|Ga0070679_100699356	All Organisms → cellular organisms → Bacteria	956	Open in IMG/M
3300005539\|Ga0068853_101431343	All Organisms → cellular organisms → Bacteria → Proteobacteria	669	Open in IMG/M
3300005577\|Ga0068857_100698277	All Organisms → cellular organisms → Bacteria → Proteobacteria	964	Open in IMG/M
3300005578\|Ga0068854_102009859	All Organisms → cellular organisms → Bacteria	533	Open in IMG/M
3300005614\|Ga0068856_100875019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	917	Open in IMG/M
3300005617\|Ga0068859_100078280	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3346	Open in IMG/M
3300005764\|Ga0066903_106161718	All Organisms → cellular organisms → Bacteria	627	Open in IMG/M
3300006049\|Ga0075417_10213942	All Organisms → cellular organisms → Bacteria	916	Open in IMG/M
3300006844\|Ga0075428_100408641	All Organisms → cellular organisms → Bacteria → Proteobacteria	1455	Open in IMG/M
3300006871\|Ga0075434_102445512	All Organisms → cellular organisms → Bacteria → Proteobacteria	524	Open in IMG/M
3300006881\|Ga0068865_100090963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2213	Open in IMG/M
3300006881\|Ga0068865_101354756	All Organisms → cellular organisms → Bacteria	634	Open in IMG/M
3300006930\|Ga0079303_10155208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	897	Open in IMG/M
3300007281\|Ga0104349_1007519	Not Available	543	Open in IMG/M
3300009179\|Ga0115028_11352239	All Organisms → cellular organisms → Bacteria → Proteobacteria	596	Open in IMG/M
3300009540\|Ga0073899_10221672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1434	Open in IMG/M
3300010159\|Ga0099796_10403139	Not Available	600	Open in IMG/M
3300010304\|Ga0134088_10421635	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	652	Open in IMG/M
3300010360\|Ga0126372_13254131	Not Available	505	Open in IMG/M
3300010396\|Ga0134126_12603778	Not Available	549	Open in IMG/M
3300010880\|Ga0126350_10591456	Not Available	716	Open in IMG/M
3300012200\|Ga0137382_11105713	Not Available	566	Open in IMG/M
3300012207\|Ga0137381_11039326	All Organisms → cellular organisms → Bacteria → Proteobacteria	706	Open in IMG/M
3300012285\|Ga0137370_10100133	All Organisms → cellular organisms → Bacteria	1631	Open in IMG/M
3300012903\|Ga0157289_10420308	Not Available	507	Open in IMG/M
3300012905\|Ga0157296_10206019	All Organisms → cellular organisms → Bacteria	631	Open in IMG/M
3300012910\|Ga0157308_10162168	Not Available	724	Open in IMG/M
3300012958\|Ga0164299_10780588	Not Available	679	Open in IMG/M
3300012977\|Ga0134087_10774167	Not Available	517	Open in IMG/M
3300013296\|Ga0157374_11320751	Not Available	743	Open in IMG/M
3300013306\|Ga0163162_12811494	Not Available	560	Open in IMG/M
3300013308\|Ga0157375_13038790	Not Available	560	Open in IMG/M
3300014323\|Ga0075356_1119583	Not Available	650	Open in IMG/M
3300014325\|Ga0163163_10406618	All Organisms → cellular organisms → Bacteria	1420	Open in IMG/M
3300014745\|Ga0157377_10872685	Not Available	670	Open in IMG/M
3300015371\|Ga0132258_12039296	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1443	Open in IMG/M
3300015374\|Ga0132255_100393129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2017	Open in IMG/M
3300015374\|Ga0132255_101779634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	936	Open in IMG/M
3300015374\|Ga0132255_102007598	Not Available	880	Open in IMG/M
3300016404\|Ga0182037_11860791	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales	538	Open in IMG/M
3300017965\|Ga0190266_10844822	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	593	Open in IMG/M
3300018000\|Ga0184604_10300328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	567	Open in IMG/M
3300018081\|Ga0184625_10606593	Not Available	536	Open in IMG/M
3300021344\|Ga0193719_10424009	Not Available	545	Open in IMG/M
3300025321\|Ga0207656_10273195	Not Available	832	Open in IMG/M
3300025735\|Ga0207713_1172211	Not Available	682	Open in IMG/M
3300025901\|Ga0207688_10995389	All Organisms → cellular organisms → Bacteria → Proteobacteria	530	Open in IMG/M
3300025912\|Ga0207707_10812729	Not Available	778	Open in IMG/M
3300025912\|Ga0207707_11405840	Not Available	556	Open in IMG/M
3300025920\|Ga0207649_11211223	All Organisms → cellular organisms → Bacteria → Proteobacteria	597	Open in IMG/M
3300025920\|Ga0207649_11500645	Not Available	534	Open in IMG/M
3300025921\|Ga0207652_10682247	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024	917	Open in IMG/M
3300025937\|Ga0207669_11320301	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	613	Open in IMG/M
3300025937\|Ga0207669_11574610	Not Available	561	Open in IMG/M
3300025938\|Ga0207704_10811763	Not Available	782	Open in IMG/M
3300025940\|Ga0207691_10092989	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2700	Open in IMG/M
3300025945\|Ga0207679_10024389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4147	Open in IMG/M
3300025949\|Ga0207667_12252784	Not Available	501	Open in IMG/M
3300025961\|Ga0207712_11158737	Not Available	689	Open in IMG/M
3300025981\|Ga0207640_11190512	Not Available	677	Open in IMG/M
3300025986\|Ga0207658_11027651	Not Available	752	Open in IMG/M
3300026035\|Ga0207703_11008567	Not Available	799	Open in IMG/M
3300026035\|Ga0207703_12342077	All Organisms → cellular organisms → Bacteria → Proteobacteria	510	Open in IMG/M
3300026088\|Ga0207641_11470715	All Organisms → cellular organisms → Bacteria	683	Open in IMG/M
3300026089\|Ga0207648_11121726	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	738	Open in IMG/M
3300026095\|Ga0207676_10162659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1935	Open in IMG/M
3300026281\|Ga0209863_10067804	Not Available	1055	Open in IMG/M
3300026547\|Ga0209156_10486687	All Organisms → cellular organisms → Bacteria → Proteobacteria	510	Open in IMG/M
3300027873\|Ga0209814_10176635	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	919	Open in IMG/M
3300027897\|Ga0209254_10044852	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3887	Open in IMG/M
3300027897\|Ga0209254_11103640	Not Available	507	Open in IMG/M
3300027899\|Ga0209668_10141525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1449	Open in IMG/M
3300027975\|Ga0209391_10207131	Not Available	811	Open in IMG/M
3300028381\|Ga0268264_10600319	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300028865\|Ga0302291_10315158	Not Available	538	Open in IMG/M
3300029987\|Ga0311334_10243831	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1388	Open in IMG/M
3300029990\|Ga0311336_10076158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2627	Open in IMG/M
3300029990\|Ga0311336_10083821	All Organisms → cellular organisms → Bacteria → Proteobacteria	2507	Open in IMG/M
3300030001\|Ga0302272_1206410	Not Available	516	Open in IMG/M
3300030002\|Ga0311350_11522332	Not Available	593	Open in IMG/M
3300030838\|Ga0311335_11073983	Not Available	575	Open in IMG/M
3300030943\|Ga0311366_11795546	Not Available	523	Open in IMG/M
3300031250\|Ga0265331_10004185	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9045	Open in IMG/M
3300031740\|Ga0307468_100559744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	923	Open in IMG/M
3300031854\|Ga0310904_10387295	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	912	Open in IMG/M
3300031873\|Ga0315297_10209423	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1607	Open in IMG/M
3300031873\|Ga0315297_10403348	Not Available	1147	Open in IMG/M
3300031902\|Ga0302322_100230309	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2043	Open in IMG/M
3300031902\|Ga0302322_101610364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4	794	Open in IMG/M
3300031913\|Ga0310891_10348715	Not Available	531	Open in IMG/M
3300031939\|Ga0308174_10780023	Not Available	802	Open in IMG/M
3300031942\|Ga0310916_10304520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1350	Open in IMG/M
3300031997\|Ga0315278_10908397	Not Available	883	Open in IMG/M
3300032055\|Ga0318575_10244886	Not Available	904	Open in IMG/M
3300032074\|Ga0308173_11147028	Not Available	725	Open in IMG/M
3300032143\|Ga0315292_10365748	Not Available	1208	Open in IMG/M
3300032143\|Ga0315292_11508201	Not Available	544	Open in IMG/M
3300032164\|Ga0315283_10095829	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219	3096	Open in IMG/M
3300032177\|Ga0315276_12285402	Not Available	546	Open in IMG/M
3300032180\|Ga0307471_102271788	Not Available	684	Open in IMG/M
3300032205\|Ga0307472_100743396	Not Available	888	Open in IMG/M
3300032397\|Ga0315287_11023945	Not Available	960	Open in IMG/M
3300032401\|Ga0315275_12646119	Not Available	517	Open in IMG/M
3300032516\|Ga0315273_10704244	All Organisms → cellular organisms → Bacteria → Proteobacteria	1327	Open in IMG/M
3300032516\|Ga0315273_11954749	Not Available	699	Open in IMG/M
3300032770\|Ga0335085_11038492	Not Available	883	Open in IMG/M
3300033408\|Ga0316605_10296631	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1415	Open in IMG/M
3300033412\|Ga0310810_10292327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1757	Open in IMG/M
3300033413\|Ga0316603_10791068	Not Available	890	Open in IMG/M
3300033413\|Ga0316603_11464410	Not Available	647	Open in IMG/M
3300033483\|Ga0316629_11340135	All Organisms → cellular organisms → Bacteria → Proteobacteria	577	Open in IMG/M
3300033488\|Ga0316621_10589638	Not Available	790	Open in IMG/M
3300034090\|Ga0326723_0018963	All Organisms → cellular organisms → Bacteria → Proteobacteria	2795	Open in IMG/M
3300034090\|Ga0326723_0251735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	788	Open in IMG/M
3300034129\|Ga0370493_0238648	Not Available	613	Open in IMG/M
3300034965\|Ga0370497_0012755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1625	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	64.06%
Host-Associated	Host-Associated	34.38%
Engineered	Engineered	1.56%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	47.66%
Plants	Host-Associated → Plants	34.38%
Aquatic	Environmental → Aquatic	16.41%
Wastewater	Engineered → Wastewater	1.56%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	37.50%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.97%
Rhizosphere	Host-Associated → Plants → Rhizosphere	15.62%
Freshwater	Environmental → Aquatic → Freshwater	14.06%
Peat	Environmental → Terrestrial → Peat	9.38%
Sediment	Environmental → Aquatic → Sediment	1.56%
Activated Sludge	Engineered → Wastewater → Activated Sludge	1.56%
Marine	Environmental → Aquatic → Marine	0.78%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	0.78%
Roots	Host-Associated → Plants → Roots	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	21.09%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.84%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	9.38%
Lake	Environmental → Aquatic → Freshwater → Lake	8.59%
Loam	Environmental → Terrestrial → Soil → Loam	8.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.59%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.81%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.12%
Lentic	Environmental → Aquatic → Freshwater → Lentic	2.34%
Sediment	Environmental → Aquatic → Freshwater → Sediment	1.56%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.56%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	1.56%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	0.78%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.78%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.84%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	12.50%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	9.38%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	8.59%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.81%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.03%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.69%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.12%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.12%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	2.34%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	1.56%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	1.56%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.56%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	1.56%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.78%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.78%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.78%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.78%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	0.78%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.78%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	8.59%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	7.03%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.47%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.47%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.69%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.91%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.91%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.12%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.12%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.12%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	3.12%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.12%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.12%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	2.34%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.34%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.34%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	1.56%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.56%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.56%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.56%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	1.56%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	1.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.56%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.56%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.78%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.78%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.78%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.78%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.78%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.78%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.78%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.78%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	0.78%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.78%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.78%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.78%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.78%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.78%
Aeration Tank Of Activated Sludge Process	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process	0.78%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.78%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental	Open in IMG/M
3300004635	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental	Open in IMG/M
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated	Open in IMG/M
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Environmental	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006930	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC	Environmental	Open in IMG/M
3300007281	Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B	Engineered	Open in IMG/M
3300009179	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1	Environmental	Open in IMG/M
3300009540	Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph	Engineered	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012910	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014323	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300017965	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026281	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)	Environmental	Open in IMG/M
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300027897	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)	Environmental	Open in IMG/M
3300027899	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)	Environmental	Open in IMG/M
3300027975	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes)	Environmental	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028865	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029990	I_Fen_N2 coassembly	Environmental	Open in IMG/M
3300030001	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2	Environmental	Open in IMG/M
3300030002	II_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030838	I_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031902	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2	Environmental	Open in IMG/M
3300031913	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032055	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032164	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0	Environmental	Open in IMG/M
3300032177	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental	Open in IMG/M
3300032401	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0	Environmental	Open in IMG/M
3300032516	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033483	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A	Environmental	Open in IMG/M
3300033488	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034129	Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16	Environmental	Open in IMG/M
3300034965	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.51
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.51
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F064484

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0055498_100435951	3300004058	Natural And Restored Wetlands	MSAIVVENASKHWATADGQVRAVDRLSFALDEGTLNVLLGPSGCG
Ga0062384_1000404041	3300004082	Bog Forest Soil	VAAIVVENISKHWTGAGGQVRAVDGLSFTLDEGTLNVLLGPSGCG
Ga0062388_1016866812	3300004635	Bog Forest Soil	VAAIVVENVSKHWTGAGGQVRAVDELSFTLDEGTLNVLLGPSGCG
Ga0070676_102218721	3300005328	Miscanthus Rhizosphere	VSAIAVDNVSKHWSTADGKVRAVDGISFALAEGTLNVLLGPSG
Ga0070683_1010795382	3300005329	Corn Rhizosphere	VSAIAAVAVSKHWVTGEARVRAVDSISFEFAAGTLNVLLGP
Ga0070692_101191481	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLGPS
Ga0070673_1023152072	3300005364	Switchgrass Rhizosphere	MSAIAAEQLCKHWTTANGRVHAVDGISFEFDAGTLNVLLGP
Ga0070711_1016272821	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MSAIVADAVGKHWATSDGRVRAVDGISFEFAPATLNVLLGPSGCG
Ga0070705_1017463601	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	VPGGALSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNVLLGPSGC
Ga0070662_1017757252	3300005457	Corn Rhizosphere	MSAIAALHVSKVWNTGEGSLRAVDDVSFAFDAGTLNVLLGPS
Ga0070699_1001404694	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLLGPS
Ga0070699_1004421033	3300005518	Corn, Switchgrass And Miscanthus Rhizosphere	VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLLGP
Ga0070679_1006993561	3300005530	Corn Rhizosphere	MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLG
Ga0068853_1014313431	3300005539	Corn Rhizosphere	VSAILAENLSKHWATADGEVRAVDGVTFEFDEGTLNVLLG
Ga0068857_1006982771	3300005577	Corn Rhizosphere	VSAIAAVAVSKHWVTGEARVRAVDSISFEFAPGTLNVLLGPSGCG
Ga0068854_1020098592	3300005578	Corn Rhizosphere	MSAIAAERVSKVWMTGASPVRAVDDVSFAFDAGTLNVLL
Ga0068856_1008750192	3300005614	Corn Rhizosphere	LSAIVVENVSKHWTTPAGMVRAVEGLSFSLDAGTLNV
Ga0068859_1000782801	3300005617	Switchgrass Rhizosphere	VAAIALDNVSKHWTTAGGKVHAVNDLSFAFEPGTLNVLLGP
Ga0066903_1061617182	3300005764	Tropical Forest Soil	VSAIVAEGIAKHWTTADGEVRAVDGLSFAFEQGTLNVLLG
Ga0075417_102139421	3300006049	Populus Rhizosphere	VSAIAVENVSKHWTTAEGQVRAVDGLSFALDEGTLNVL
Ga0075428_1004086413	3300006844	Populus Rhizosphere	LSAIAAENVSKHWTTADGKVRAVDEISFAFDEGTLNVLLGP
Ga0075434_1024455121	3300006871	Populus Rhizosphere	VSAIAAENVSKHWTTVDGEVRAVDRLTFAFDEGTLNVLLGPSGCG
Ga0068865_1000909631	3300006881	Miscanthus Rhizosphere	VSAIAVENVSKHWTTPSGQVRAVDAISFELAAGTFNVLL
Ga0068865_1013547562	3300006881	Miscanthus Rhizosphere	VSAIAAENVSKHWTTADGKVRAVDGLSFAFDEGTLNVLLGP
Ga0079303_101552081	3300006930	Deep Subsurface	MSAIAAEGISKHWTTREGKVYAVDRLSFELEPGTLNVLL
Ga0104349_10075192	3300007281	Aeration Tank Of Activated Sludge Process	VSAIVVEGASKHWTTGDGKVRAVDRLSFSLDAGTLNVLLGPSGC
Ga0115028_113522392	3300009179	Wetland	MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGPSG
Ga0073899_102216721	3300009540	Activated Sludge	VSAIAVENVSKHWTTADGQVRAVDAITFALEPGTLNVLLGPT
Ga0099796_104031391	3300010159	Vadose Zone Soil	MSAIAAENVSKHWKTTGGQVRAVDAISFEFDPGTLNVLLGPSGC
Ga0134088_104216352	3300010304	Grasslands Soil	VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLL
Ga0126372_132541312	3300010360	Tropical Forest Soil	VSAIVAEGIAKHWTTADGDVRAVDDLTLAFDRGTLNVLLVPSG*
Ga0134126_126037781	3300010396	Terrestrial Soil	MSAIAAERVSKLWATAEGAVRAVDEVSFAFEAGTLNVLL
Ga0126350_105914561	3300010880	Boreal Forest Soil	VSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNV
Ga0137382_111057132	3300012200	Vadose Zone Soil	MSAIAAENVSKHWSTTGGVVRAVDAITFGFAPGTLNVLLGPSGC
Ga0137381_110393262	3300012207	Vadose Zone Soil	VSAIAVENISKHWTTAAGQIRAVDEISFALDSGTLNVLLGPSGCG
Ga0137370_101001333	3300012285	Vadose Zone Soil	VSAIAVENVSKHWTTTSGQVRAVDSISFALDPGTL
Ga0157289_104203081	3300012903	Soil	VSAILAENLSKHWATAEGEVRAVDRVTFAFDEGTLNVL
Ga0157296_102060191	3300012905	Soil	VSAIVVEGASKHWATGDGQVRAVDRLSFALDEGTLNVLLGPSGC
Ga0157308_101621681	3300012910	Soil	LSAIAAENVSKHWTTADGKVRAVDGLSFQFAEGTLNVL
Ga0164299_107805881	3300012958	Soil	VSAILAENLSKHWTTAEGEVRAVDRISFAFDAGTL
Ga0134087_107741672	3300012977	Grasslands Soil	VSTIAAENVSKHWTTADGKVRAVDGLSFEFDEGTLNVLL
Ga0157374_113207512	3300013296	Miscanthus Rhizosphere	MSAIVAENLSKHWATADGEVRAVDGMRLAFDEGTLNGLMARSG
Ga0163162_128114941	3300013306	Switchgrass Rhizosphere	LGERVVVSAIVAENLSKHWTTADGDVRAVDRLSFAFDE
Ga0157375_130387901	3300013308	Miscanthus Rhizosphere	LSAIAAENLSKHWTTADGDVRAVDAVSFEFDEGTLNVLLGP
Ga0075356_11195831	3300014323	Natural And Restored Wetlands	MSAIAVLNVSKHWTTADGQVRAVDAISFELAAGTFNVLL
Ga0163163_104066181	3300014325	Switchgrass Rhizosphere	VSAIAVESVSKHWTTADGRVRAVDGVSFRFAEGTL
Ga0157377_108726851	3300014745	Miscanthus Rhizosphere	MSAIAAERVSKIWASAERPVRAVDDVSFAFDAGTLNVLL
Ga0132258_120392961	3300015371	Arabidopsis Rhizosphere	VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVLL
Ga0132255_1003931293	3300015374	Arabidopsis Rhizosphere	VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVLLGPS
Ga0132255_1017796342	3300015374	Arabidopsis Rhizosphere	VSAITVENVSKHWTTAGGQVRAVDDVSFELDPGTL
Ga0132255_1020075981	3300015374	Arabidopsis Rhizosphere	LSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNVLL
Ga0182037_118607911	3300016404	Soil	MQVSAIVAEGIAKHWTTADGDVRAVDGLSFAFDRGTLNVLLGPS
Ga0190266_108448221	3300017965	Soil	VSAILAENLSKHWATAEGEVRAVDRVTFAFDEGTLNVLL
Ga0184604_103003281	3300018000	Groundwater Sediment	MSAIAAANVSKHWTTSGGKVHAVNALSFAFEPGTLNVLLG
Ga0184625_106065931	3300018081	Groundwater Sediment	VSAIAVDNVSKHWTTAHGQVHAVDGISFALEAGTLNV
Ga0193719_104240091	3300021344	Soil	MSAIAAENVSKHWTTAGGQVRAVDAISFEFDPGTLNVLL
Ga0207656_102731951	3300025321	Corn Rhizosphere	MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLGP
Ga0207713_11722111	3300025735	Switchgrass Rhizosphere	VSAIAVDNVSKHWTTAHGQVHAVDGISFALQAGTLNVLLGP
Ga0207688_109953891	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	VSAIAVDNVSKHWTTAHGQVHAVDGISFALQAGTLNVLLGPSGC
Ga0207707_108127292	3300025912	Corn Rhizosphere	MSAIAAEKVSKVWTTGGAAVRAVDDVSFAFDAGTLNVL
Ga0207707_114058401	3300025912	Corn Rhizosphere	MSAIAAEHVSKVWATSGAPVRAVDDVSFAFDAGTL
Ga0207649_112112232	3300025920	Corn Rhizosphere	VSAIAAQGLAKHWTTTDGAVRAVDDVSFAFDAGTLNVLLGP
Ga0207649_115006451	3300025920	Corn Rhizosphere	VAAIALDNVSKHWTTAGGKVHAVNDLSFAFEPGTLN
Ga0207652_106822472	3300025921	Corn Rhizosphere	MSAIAAEHVSKVWATSEGLVRAVDDVAFAFDEGTLNV
Ga0207669_113203011	3300025937	Miscanthus Rhizosphere	VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVL
Ga0207669_115746102	3300025937	Miscanthus Rhizosphere	VSAIAVDNVSKHWSTADGKVRAVDGISFALAEGTLNVLL
Ga0207704_108117631	3300025938	Miscanthus Rhizosphere	LSAIAAENVSKHWTTADGDVRAVDGLSFAFDEGTLNVLL
Ga0207691_100929891	3300025940	Miscanthus Rhizosphere	LSAIAAENLSKHWTTTDGNVRAVDAVSFEFDEGTLNVL
Ga0207679_100243898	3300025945	Corn Rhizosphere	MSAIAAERVSKIWASAEGPVRAVDDVSFAFDAGTLN
Ga0207667_122527841	3300025949	Corn Rhizosphere	LSAIVVENVSKHWTTPAGMVRAVEGLSFSLDAGTL
Ga0207712_111587371	3300025961	Switchgrass Rhizosphere	VSAIAVESVSKHWTTADGRVRAVDGVSFRFAEGTLNVLL
Ga0207640_111905121	3300025981	Corn Rhizosphere	VSAILAENLSKHWATAEGEVRAVDHVTFAFDEGTLNV
Ga0207658_110276511	3300025986	Switchgrass Rhizosphere	VSAIAVENVSKHWTTPSGQVRAVDAISFELAAGTFN
Ga0207703_110085671	3300026035	Switchgrass Rhizosphere	VSAIAVENVSKHWTTADGSVRAVDGVSFRFAEGTLNVL
Ga0207703_123420772	3300026035	Switchgrass Rhizosphere	VSAIVAANVSKHWTTAEGKVCAVDALSFAFDPGTLNVL
Ga0207641_114707151	3300026088	Switchgrass Rhizosphere	VSAIVVEGASKHWTTGDGQVRAVDRISFALDEGTLNV
Ga0207648_111217262	3300026089	Miscanthus Rhizosphere	VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVLLGPTGC
Ga0207676_101626591	3300026095	Switchgrass Rhizosphere	VSAIAAENVSKHWTTADGNVRAVDGLSFEFDEGTLN
Ga0209863_100678042	3300026281	Prmafrost Soil	VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTF
Ga0209156_104866871	3300026547	Soil	VSAIAVENVAKHWTTAAGQVRAVDGLSFALEEGTLNVLLGPSGC
Ga0209814_101766351	3300027873	Populus Rhizosphere	VSAIAVENVSKHWTTAEGQVRAVDGLSFALDEGTLNVLL
Ga0209254_100448521	3300027897	Freshwater Lake Sediment	VSAIAVENVSKHWSTADGNVRAVDAISFALDPGTLNV
Ga0209254_111036401	3300027897	Freshwater Lake Sediment	VSAIVAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVLLGP
Ga0209668_101415253	3300027899	Freshwater Lake Sediment	VAAIVVEGASKHWTTAEGQVRAVDSISFSLDEGTLN
Ga0209391_102071312	3300027975	Freshwater Sediment	VSAISLRRVSKHWTTPQGQVQAVSDLSFDLEPGTLNVLL
Ga0268264_106003191	3300028381	Switchgrass Rhizosphere	VSAIVVEGASKHWATGDGQVRAVDRLSFALDEGTLNVLL
Ga0302291_103151581	3300028865	Fen	VSVIAVENVSKHWTTADGQVRAVDAISFELAAGTFNVLL
Ga0311334_102438313	3300029987	Fen	VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFNVL
Ga0311336_100761584	3300029990	Fen	VSAIAVENVSKHWTTATAQVRAVDNVSFALDAGTLNVLLGPS
Ga0311336_100838214	3300029990	Fen	VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFN
Ga0302272_12064101	3300030001	Bog	VSAIAVENVSKHWTTADGQVRAVDAISFDLAQGTFNV
Ga0311350_115223321	3300030002	Fen	VSAIVVENISKHWTTSDGQVRAVDAISFDLAAGTFNVLLGP
Ga0311335_110739831	3300030838	Fen	VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFNV
Ga0311366_117955462	3300030943	Fen	VSAIAAEYVSKHWTTAAGEVRAVDGLSFAFDEGTLNV
Ga0265331_1000418512	3300031250	Rhizosphere	VSAIIAEGVSKHWTTTEGDVRAVDGLSFAFEPGTLNVL
Ga0307468_1005597441	3300031740	Hardwood Forest Soil	VSAIAVENVSKHWATAEGQVRAVDALSFAFDEGTLNVLLG
Ga0310904_103872952	3300031854	Soil	VSAIAVDNVSKHWSTADGQVRAVDGVSFSLAEGTLNVLLGPSG
Ga0315297_102094233	3300031873	Sediment	VSAIAVEDVSKHWTTADGQVRAVDAISFELAAGTFN
Ga0315297_104033483	3300031873	Sediment	VSAIAVESVSKHWTTADGQVRAVDAISFELAAGTFNV
Ga0302322_1002303093	3300031902	Fen	MVSAIAVENVSKHWTTADGRVHAVDAISFALEPGTLNVLLGPSG
Ga0302322_1016103641	3300031902	Fen	VSAIAAENVSKHWTTADGEVRAVDGLSFAFDEGTLNVLL
Ga0310891_103487152	3300031913	Soil	MSAIAAERVSKIWASAEGPVRAVDDVSFAFDAGTLNV
Ga0308174_107800232	3300031939	Soil	VSAIAVDNVSKHWSTADGHVRAVDGISFSLAEGTLNV
Ga0310916_103045201	3300031942	Soil	MSAIALDRVSKHWTTAGGKVHAVDDLTFAFEPGTLNVLLGPS
Ga0315278_109083972	3300031997	Sediment	VSAIAAENISKHWTTADGEVRAVDRLSFAFDEGTLNV
Ga0318575_102448862	3300032055	Soil	VSAIAVENVSKHWTTAEGQVRAVDALSFSLDEGTFNVLLGPS
Ga0308173_111470281	3300032074	Soil	MSAIAAEHVSKVWATGAAPVRAVDDVSFAFDAGTLNVLL
Ga0315292_103657481	3300032143	Sediment	VSAIAVEKVSKHWTTADGRVRAVDAISFALDPGTLNVLLGPSG
Ga0315292_115082012	3300032143	Sediment	MESVIVSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVL
Ga0315283_100958291	3300032164	Sediment	VSAIVAENLSKRWTTADGDVRAVDGVSFAFDEGTL
Ga0315276_122854021	3300032177	Sediment	VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVL
Ga0307471_1022717882	3300032180	Hardwood Forest Soil	VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNV
Ga0307472_1007433961	3300032205	Hardwood Forest Soil	VSAIVAEGISKHWTTADGEVRAVDGLSFAFDRGTLNVLLG
Ga0315287_110239452	3300032397	Sediment	VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLN
Ga0315275_126461192	3300032401	Sediment	VSAIAAENVSKHWTTAEGQVRAVDGLSFAFDKGTLNVLLGP
Ga0315273_107042441	3300032516	Sediment	VSAIAVEDVSKHWTTADGQVRAVDAISFELAAGTFNVL
Ga0315273_119547492	3300032516	Sediment	VSAIAAENVSKHWMTAEGEVRAVDRLSFAFDEGTLNVLLGPSGCGK
Ga0335085_110384922	3300032770	Soil	LSAIAAENVSKHWTTAEGEVRAVDRLSFAFDAGTLNVLLGPSG
Ga0316605_102966313	3300033408	Soil	MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGP
Ga0310810_102923271	3300033412	Soil	MSAIVAENLSKHWATADGEVRAVDGITFAFDEGTLN
Ga0316603_107910681	3300033413	Soil	VSAIVAENLSKHWTTADGEVRAVDGLSFAFDEGTLNVLLGP
Ga0316603_114644101	3300033413	Soil	VSAIAAEDVSKHWTTAEGKVHAVDGITFAFDEGTLNVLL
Ga0316629_113401351	3300033483	Soil	MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGPSGCGK
Ga0316621_105896381	3300033488	Soil	MSAIAAEGISKHWTTREGKVHAVDRLSFELEPGTL
Ga0326723_0018963_1_111	3300034090	Peat Soil	MRPKGPSVSAIAAENISKHWTTADGQVRAVDGLSFAF
Ga0326723_0251735_239_388	3300034090	Peat Soil	VSAIAVENLSKHWTTAEGQVRAVDGLSFALDEGTLNGPLGPSIRWSRVR
Ga0370493_0238648_2_112	3300034129	Untreated Peat Soil	VSAITVENVSKHWTTSDGQVRAVDAISFELAAGTFNV
Ga0370497_0012755_1484_1624	3300034965	Untreated Peat Soil	MARLAQQGEAVSAIAVENVSKHWTTAAGQVRAVDNVSFALEPGTLNV

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign