| Basic Information | |
|---|---|
| Family ID | F064484 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 128 |
| Average Sequence Length | 39 residues |
| Representative Sequence | VSAIAAENVSKHWTTADGEVRAVDGLSFAFDEGTLNVLL |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 128 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 73.44 % |
| % of genes near scaffold ends (potentially truncated) | 98.44 % |
| % of genes from short scaffolds (< 2000 bps) | 89.06 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (52.344 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (8.594 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.938 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.312 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 32.84% Coil/Unstructured: 67.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 128 Family Scaffolds |
|---|---|---|
| PF00218 | IGPS | 78.91 |
| PF00591 | Glycos_transf_3 | 4.69 |
| PF02885 | Glycos_trans_3N | 1.56 |
| PF00117 | GATase | 1.56 |
| PF00583 | Acetyltransf_1 | 1.56 |
| PF00425 | Chorismate_bind | 0.78 |
| PF07043 | DUF1328 | 0.78 |
| PF13540 | RCC1_2 | 0.78 |
| PF00903 | Glyoxalase | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 128 Family Scaffolds |
|---|---|---|---|
| COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 78.91 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.47 % |
| Unclassified | root | N/A | 44.53 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004058|Ga0055498_10043595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 769 | Open in IMG/M |
| 3300004082|Ga0062384_100040404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2185 | Open in IMG/M |
| 3300004635|Ga0062388_101686681 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 647 | Open in IMG/M |
| 3300005328|Ga0070676_10221872 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
| 3300005329|Ga0070683_101079538 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005345|Ga0070692_10119148 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1470 | Open in IMG/M |
| 3300005364|Ga0070673_102315207 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005439|Ga0070711_101627282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 565 | Open in IMG/M |
| 3300005440|Ga0070705_101746360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 527 | Open in IMG/M |
| 3300005457|Ga0070662_101775725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300005518|Ga0070699_100140469 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2132 | Open in IMG/M |
| 3300005518|Ga0070699_100442103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300005530|Ga0070679_100699356 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005539|Ga0068853_101431343 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
| 3300005577|Ga0068857_100698277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300005578|Ga0068854_102009859 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300005614|Ga0068856_100875019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 917 | Open in IMG/M |
| 3300005617|Ga0068859_100078280 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3346 | Open in IMG/M |
| 3300005764|Ga0066903_106161718 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300006049|Ga0075417_10213942 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300006844|Ga0075428_100408641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1455 | Open in IMG/M |
| 3300006871|Ga0075434_102445512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
| 3300006881|Ga0068865_100090963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2213 | Open in IMG/M |
| 3300006881|Ga0068865_101354756 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006930|Ga0079303_10155208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 897 | Open in IMG/M |
| 3300007281|Ga0104349_1007519 | Not Available | 543 | Open in IMG/M |
| 3300009179|Ga0115028_11352239 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
| 3300009540|Ga0073899_10221672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1434 | Open in IMG/M |
| 3300010159|Ga0099796_10403139 | Not Available | 600 | Open in IMG/M |
| 3300010304|Ga0134088_10421635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 652 | Open in IMG/M |
| 3300010360|Ga0126372_13254131 | Not Available | 505 | Open in IMG/M |
| 3300010396|Ga0134126_12603778 | Not Available | 549 | Open in IMG/M |
| 3300010880|Ga0126350_10591456 | Not Available | 716 | Open in IMG/M |
| 3300012200|Ga0137382_11105713 | Not Available | 566 | Open in IMG/M |
| 3300012207|Ga0137381_11039326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
| 3300012285|Ga0137370_10100133 | All Organisms → cellular organisms → Bacteria | 1631 | Open in IMG/M |
| 3300012903|Ga0157289_10420308 | Not Available | 507 | Open in IMG/M |
| 3300012905|Ga0157296_10206019 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012910|Ga0157308_10162168 | Not Available | 724 | Open in IMG/M |
| 3300012958|Ga0164299_10780588 | Not Available | 679 | Open in IMG/M |
| 3300012977|Ga0134087_10774167 | Not Available | 517 | Open in IMG/M |
| 3300013296|Ga0157374_11320751 | Not Available | 743 | Open in IMG/M |
| 3300013306|Ga0163162_12811494 | Not Available | 560 | Open in IMG/M |
| 3300013308|Ga0157375_13038790 | Not Available | 560 | Open in IMG/M |
| 3300014323|Ga0075356_1119583 | Not Available | 650 | Open in IMG/M |
| 3300014325|Ga0163163_10406618 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300014745|Ga0157377_10872685 | Not Available | 670 | Open in IMG/M |
| 3300015371|Ga0132258_12039296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1443 | Open in IMG/M |
| 3300015374|Ga0132255_100393129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2017 | Open in IMG/M |
| 3300015374|Ga0132255_101779634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024 | 936 | Open in IMG/M |
| 3300015374|Ga0132255_102007598 | Not Available | 880 | Open in IMG/M |
| 3300016404|Ga0182037_11860791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 538 | Open in IMG/M |
| 3300017965|Ga0190266_10844822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 593 | Open in IMG/M |
| 3300018000|Ga0184604_10300328 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 567 | Open in IMG/M |
| 3300018081|Ga0184625_10606593 | Not Available | 536 | Open in IMG/M |
| 3300021344|Ga0193719_10424009 | Not Available | 545 | Open in IMG/M |
| 3300025321|Ga0207656_10273195 | Not Available | 832 | Open in IMG/M |
| 3300025735|Ga0207713_1172211 | Not Available | 682 | Open in IMG/M |
| 3300025901|Ga0207688_10995389 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 530 | Open in IMG/M |
| 3300025912|Ga0207707_10812729 | Not Available | 778 | Open in IMG/M |
| 3300025912|Ga0207707_11405840 | Not Available | 556 | Open in IMG/M |
| 3300025920|Ga0207649_11211223 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300025920|Ga0207649_11500645 | Not Available | 534 | Open in IMG/M |
| 3300025921|Ga0207652_10682247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Azonexaceae → Dechloromonas → unclassified Dechloromonas → Dechloromonas sp. HYN0024 | 917 | Open in IMG/M |
| 3300025937|Ga0207669_11320301 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 613 | Open in IMG/M |
| 3300025937|Ga0207669_11574610 | Not Available | 561 | Open in IMG/M |
| 3300025938|Ga0207704_10811763 | Not Available | 782 | Open in IMG/M |
| 3300025940|Ga0207691_10092989 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 2700 | Open in IMG/M |
| 3300025945|Ga0207679_10024389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4147 | Open in IMG/M |
| 3300025949|Ga0207667_12252784 | Not Available | 501 | Open in IMG/M |
| 3300025961|Ga0207712_11158737 | Not Available | 689 | Open in IMG/M |
| 3300025981|Ga0207640_11190512 | Not Available | 677 | Open in IMG/M |
| 3300025986|Ga0207658_11027651 | Not Available | 752 | Open in IMG/M |
| 3300026035|Ga0207703_11008567 | Not Available | 799 | Open in IMG/M |
| 3300026035|Ga0207703_12342077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300026088|Ga0207641_11470715 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300026089|Ga0207648_11121726 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 738 | Open in IMG/M |
| 3300026095|Ga0207676_10162659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1935 | Open in IMG/M |
| 3300026281|Ga0209863_10067804 | Not Available | 1055 | Open in IMG/M |
| 3300026547|Ga0209156_10486687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300027873|Ga0209814_10176635 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 919 | Open in IMG/M |
| 3300027897|Ga0209254_10044852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3887 | Open in IMG/M |
| 3300027897|Ga0209254_11103640 | Not Available | 507 | Open in IMG/M |
| 3300027899|Ga0209668_10141525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1449 | Open in IMG/M |
| 3300027975|Ga0209391_10207131 | Not Available | 811 | Open in IMG/M |
| 3300028381|Ga0268264_10600319 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300028865|Ga0302291_10315158 | Not Available | 538 | Open in IMG/M |
| 3300029987|Ga0311334_10243831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1388 | Open in IMG/M |
| 3300029990|Ga0311336_10076158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2627 | Open in IMG/M |
| 3300029990|Ga0311336_10083821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2507 | Open in IMG/M |
| 3300030001|Ga0302272_1206410 | Not Available | 516 | Open in IMG/M |
| 3300030002|Ga0311350_11522332 | Not Available | 593 | Open in IMG/M |
| 3300030838|Ga0311335_11073983 | Not Available | 575 | Open in IMG/M |
| 3300030943|Ga0311366_11795546 | Not Available | 523 | Open in IMG/M |
| 3300031250|Ga0265331_10004185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9045 | Open in IMG/M |
| 3300031740|Ga0307468_100559744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300031854|Ga0310904_10387295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 912 | Open in IMG/M |
| 3300031873|Ga0315297_10209423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1607 | Open in IMG/M |
| 3300031873|Ga0315297_10403348 | Not Available | 1147 | Open in IMG/M |
| 3300031902|Ga0302322_100230309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2043 | Open in IMG/M |
| 3300031902|Ga0302322_101610364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4 | 794 | Open in IMG/M |
| 3300031913|Ga0310891_10348715 | Not Available | 531 | Open in IMG/M |
| 3300031939|Ga0308174_10780023 | Not Available | 802 | Open in IMG/M |
| 3300031942|Ga0310916_10304520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1350 | Open in IMG/M |
| 3300031997|Ga0315278_10908397 | Not Available | 883 | Open in IMG/M |
| 3300032055|Ga0318575_10244886 | Not Available | 904 | Open in IMG/M |
| 3300032074|Ga0308173_11147028 | Not Available | 725 | Open in IMG/M |
| 3300032143|Ga0315292_10365748 | Not Available | 1208 | Open in IMG/M |
| 3300032143|Ga0315292_11508201 | Not Available | 544 | Open in IMG/M |
| 3300032164|Ga0315283_10095829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Acidovorax → unclassified Acidovorax → Acidovorax sp. Root219 | 3096 | Open in IMG/M |
| 3300032177|Ga0315276_12285402 | Not Available | 546 | Open in IMG/M |
| 3300032180|Ga0307471_102271788 | Not Available | 684 | Open in IMG/M |
| 3300032205|Ga0307472_100743396 | Not Available | 888 | Open in IMG/M |
| 3300032397|Ga0315287_11023945 | Not Available | 960 | Open in IMG/M |
| 3300032401|Ga0315275_12646119 | Not Available | 517 | Open in IMG/M |
| 3300032516|Ga0315273_10704244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1327 | Open in IMG/M |
| 3300032516|Ga0315273_11954749 | Not Available | 699 | Open in IMG/M |
| 3300032770|Ga0335085_11038492 | Not Available | 883 | Open in IMG/M |
| 3300033408|Ga0316605_10296631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1415 | Open in IMG/M |
| 3300033412|Ga0310810_10292327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1757 | Open in IMG/M |
| 3300033413|Ga0316603_10791068 | Not Available | 890 | Open in IMG/M |
| 3300033413|Ga0316603_11464410 | Not Available | 647 | Open in IMG/M |
| 3300033483|Ga0316629_11340135 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300033488|Ga0316621_10589638 | Not Available | 790 | Open in IMG/M |
| 3300034090|Ga0326723_0018963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2795 | Open in IMG/M |
| 3300034090|Ga0326723_0251735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 788 | Open in IMG/M |
| 3300034129|Ga0370493_0238648 | Not Available | 613 | Open in IMG/M |
| 3300034965|Ga0370497_0012755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1625 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.59% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.47% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.91% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.12% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.12% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.12% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.12% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.12% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.34% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.34% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.34% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.56% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.56% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.56% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.56% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.56% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.78% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.78% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.78% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.78% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.78% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.78% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.78% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.78% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.78% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.78% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.78% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.78% |
| Aeration Tank Of Activated Sludge Process | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Aeration Tank Of Activated Sludge Process | 0.78% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300007281 | Activated sludge microbial communities from bioreactor with dissolved oxygen in CSIR-NEERI, Nagpur, India ? 2ppm of oxygen, sample B | Engineered | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009540 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB5-Ph | Engineered | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014323 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028865 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030001 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055498_100435951 | 3300004058 | Natural And Restored Wetlands | MSAIVVENASKHWATADGQVRAVDRLSFALDEGTLNVLLGPSGCG |
| Ga0062384_1000404041 | 3300004082 | Bog Forest Soil | VAAIVVENISKHWTGAGGQVRAVDGLSFTLDEGTLNVLLGPSGCG |
| Ga0062388_1016866812 | 3300004635 | Bog Forest Soil | VAAIVVENVSKHWTGAGGQVRAVDELSFTLDEGTLNVLLGPSGCG |
| Ga0070676_102218721 | 3300005328 | Miscanthus Rhizosphere | VSAIAVDNVSKHWSTADGKVRAVDGISFALAEGTLNVLLGPSG |
| Ga0070683_1010795382 | 3300005329 | Corn Rhizosphere | VSAIAAVAVSKHWVTGEARVRAVDSISFEFAAGTLNVLLGP |
| Ga0070692_101191481 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLGPS |
| Ga0070673_1023152072 | 3300005364 | Switchgrass Rhizosphere | MSAIAAEQLCKHWTTANGRVHAVDGISFEFDAGTLNVLLGP |
| Ga0070711_1016272821 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAIVADAVGKHWATSDGRVRAVDGISFEFAPATLNVLLGPSGCG |
| Ga0070705_1017463601 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VPGGALSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNVLLGPSGC |
| Ga0070662_1017757252 | 3300005457 | Corn Rhizosphere | MSAIAALHVSKVWNTGEGSLRAVDDVSFAFDAGTLNVLLGPS |
| Ga0070699_1001404694 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLLGPS |
| Ga0070699_1004421033 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLLGP |
| Ga0070679_1006993561 | 3300005530 | Corn Rhizosphere | MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLG |
| Ga0068853_1014313431 | 3300005539 | Corn Rhizosphere | VSAILAENLSKHWATADGEVRAVDGVTFEFDEGTLNVLLG |
| Ga0068857_1006982771 | 3300005577 | Corn Rhizosphere | VSAIAAVAVSKHWVTGEARVRAVDSISFEFAPGTLNVLLGPSGCG |
| Ga0068854_1020098592 | 3300005578 | Corn Rhizosphere | MSAIAAERVSKVWMTGASPVRAVDDVSFAFDAGTLNVLL |
| Ga0068856_1008750192 | 3300005614 | Corn Rhizosphere | LSAIVVENVSKHWTTPAGMVRAVEGLSFSLDAGTLNV |
| Ga0068859_1000782801 | 3300005617 | Switchgrass Rhizosphere | VAAIALDNVSKHWTTAGGKVHAVNDLSFAFEPGTLNVLLGP |
| Ga0066903_1061617182 | 3300005764 | Tropical Forest Soil | VSAIVAEGIAKHWTTADGEVRAVDGLSFAFEQGTLNVLLG |
| Ga0075417_102139421 | 3300006049 | Populus Rhizosphere | VSAIAVENVSKHWTTAEGQVRAVDGLSFALDEGTLNVL |
| Ga0075428_1004086413 | 3300006844 | Populus Rhizosphere | LSAIAAENVSKHWTTADGKVRAVDEISFAFDEGTLNVLLGP |
| Ga0075434_1024455121 | 3300006871 | Populus Rhizosphere | VSAIAAENVSKHWTTVDGEVRAVDRLTFAFDEGTLNVLLGPSGCG |
| Ga0068865_1000909631 | 3300006881 | Miscanthus Rhizosphere | VSAIAVENVSKHWTTPSGQVRAVDAISFELAAGTFNVLL |
| Ga0068865_1013547562 | 3300006881 | Miscanthus Rhizosphere | VSAIAAENVSKHWTTADGKVRAVDGLSFAFDEGTLNVLLGP |
| Ga0079303_101552081 | 3300006930 | Deep Subsurface | MSAIAAEGISKHWTTREGKVYAVDRLSFELEPGTLNVLL |
| Ga0104349_10075192 | 3300007281 | Aeration Tank Of Activated Sludge Process | VSAIVVEGASKHWTTGDGKVRAVDRLSFSLDAGTLNVLLGPSGC |
| Ga0115028_113522392 | 3300009179 | Wetland | MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGPSG |
| Ga0073899_102216721 | 3300009540 | Activated Sludge | VSAIAVENVSKHWTTADGQVRAVDAITFALEPGTLNVLLGPT |
| Ga0099796_104031391 | 3300010159 | Vadose Zone Soil | MSAIAAENVSKHWKTTGGQVRAVDAISFEFDPGTLNVLLGPSGC |
| Ga0134088_104216352 | 3300010304 | Grasslands Soil | VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNVLL |
| Ga0126372_132541312 | 3300010360 | Tropical Forest Soil | VSAIVAEGIAKHWTTADGDVRAVDDLTLAFDRGTLNVLLVPSG* |
| Ga0134126_126037781 | 3300010396 | Terrestrial Soil | MSAIAAERVSKLWATAEGAVRAVDEVSFAFEAGTLNVLL |
| Ga0126350_105914561 | 3300010880 | Boreal Forest Soil | VSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNV |
| Ga0137382_111057132 | 3300012200 | Vadose Zone Soil | MSAIAAENVSKHWSTTGGVVRAVDAITFGFAPGTLNVLLGPSGC |
| Ga0137381_110393262 | 3300012207 | Vadose Zone Soil | VSAIAVENISKHWTTAAGQIRAVDEISFALDSGTLNVLLGPSGCG |
| Ga0137370_101001333 | 3300012285 | Vadose Zone Soil | VSAIAVENVSKHWTTTSGQVRAVDSISFALDPGTL |
| Ga0157289_104203081 | 3300012903 | Soil | VSAILAENLSKHWATAEGEVRAVDRVTFAFDEGTLNVL |
| Ga0157296_102060191 | 3300012905 | Soil | VSAIVVEGASKHWATGDGQVRAVDRLSFALDEGTLNVLLGPSGC |
| Ga0157308_101621681 | 3300012910 | Soil | LSAIAAENVSKHWTTADGKVRAVDGLSFQFAEGTLNVL |
| Ga0164299_107805881 | 3300012958 | Soil | VSAILAENLSKHWTTAEGEVRAVDRISFAFDAGTL |
| Ga0134087_107741672 | 3300012977 | Grasslands Soil | VSTIAAENVSKHWTTADGKVRAVDGLSFEFDEGTLNVLL |
| Ga0157374_113207512 | 3300013296 | Miscanthus Rhizosphere | MSAIVAENLSKHWATADGEVRAVDGMRLAFDEGTLNGLMARSG |
| Ga0163162_128114941 | 3300013306 | Switchgrass Rhizosphere | LGERVVVSAIVAENLSKHWTTADGDVRAVDRLSFAFDE |
| Ga0157375_130387901 | 3300013308 | Miscanthus Rhizosphere | LSAIAAENLSKHWTTADGDVRAVDAVSFEFDEGTLNVLLGP |
| Ga0075356_11195831 | 3300014323 | Natural And Restored Wetlands | MSAIAVLNVSKHWTTADGQVRAVDAISFELAAGTFNVLL |
| Ga0163163_104066181 | 3300014325 | Switchgrass Rhizosphere | VSAIAVESVSKHWTTADGRVRAVDGVSFRFAEGTL |
| Ga0157377_108726851 | 3300014745 | Miscanthus Rhizosphere | MSAIAAERVSKIWASAERPVRAVDDVSFAFDAGTLNVLL |
| Ga0132258_120392961 | 3300015371 | Arabidopsis Rhizosphere | VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVLL |
| Ga0132255_1003931293 | 3300015374 | Arabidopsis Rhizosphere | VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVLLGPS |
| Ga0132255_1017796342 | 3300015374 | Arabidopsis Rhizosphere | VSAITVENVSKHWTTAGGQVRAVDDVSFELDPGTL |
| Ga0132255_1020075981 | 3300015374 | Arabidopsis Rhizosphere | LSAIVVENVSKHWTTAAGMVRAVEGLSFSLDAGTLNVLL |
| Ga0182037_118607911 | 3300016404 | Soil | MQVSAIVAEGIAKHWTTADGDVRAVDGLSFAFDRGTLNVLLGPS |
| Ga0190266_108448221 | 3300017965 | Soil | VSAILAENLSKHWATAEGEVRAVDRVTFAFDEGTLNVLL |
| Ga0184604_103003281 | 3300018000 | Groundwater Sediment | MSAIAAANVSKHWTTSGGKVHAVNALSFAFEPGTLNVLLG |
| Ga0184625_106065931 | 3300018081 | Groundwater Sediment | VSAIAVDNVSKHWTTAHGQVHAVDGISFALEAGTLNV |
| Ga0193719_104240091 | 3300021344 | Soil | MSAIAAENVSKHWTTAGGQVRAVDAISFEFDPGTLNVLL |
| Ga0207656_102731951 | 3300025321 | Corn Rhizosphere | MSAIAAEGVSKVWTTASGAVRAVDDVSFAFDAGTLNVLLGP |
| Ga0207713_11722111 | 3300025735 | Switchgrass Rhizosphere | VSAIAVDNVSKHWTTAHGQVHAVDGISFALQAGTLNVLLGP |
| Ga0207688_109953891 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VSAIAVDNVSKHWTTAHGQVHAVDGISFALQAGTLNVLLGPSGC |
| Ga0207707_108127292 | 3300025912 | Corn Rhizosphere | MSAIAAEKVSKVWTTGGAAVRAVDDVSFAFDAGTLNVL |
| Ga0207707_114058401 | 3300025912 | Corn Rhizosphere | MSAIAAEHVSKVWATSGAPVRAVDDVSFAFDAGTL |
| Ga0207649_112112232 | 3300025920 | Corn Rhizosphere | VSAIAAQGLAKHWTTTDGAVRAVDDVSFAFDAGTLNVLLGP |
| Ga0207649_115006451 | 3300025920 | Corn Rhizosphere | VAAIALDNVSKHWTTAGGKVHAVNDLSFAFEPGTLN |
| Ga0207652_106822472 | 3300025921 | Corn Rhizosphere | MSAIAAEHVSKVWATSEGLVRAVDDVAFAFDEGTLNV |
| Ga0207669_113203011 | 3300025937 | Miscanthus Rhizosphere | VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVL |
| Ga0207669_115746102 | 3300025937 | Miscanthus Rhizosphere | VSAIAVDNVSKHWSTADGKVRAVDGISFALAEGTLNVLL |
| Ga0207704_108117631 | 3300025938 | Miscanthus Rhizosphere | LSAIAAENVSKHWTTADGDVRAVDGLSFAFDEGTLNVLL |
| Ga0207691_100929891 | 3300025940 | Miscanthus Rhizosphere | LSAIAAENLSKHWTTTDGNVRAVDAVSFEFDEGTLNVL |
| Ga0207679_100243898 | 3300025945 | Corn Rhizosphere | MSAIAAERVSKIWASAEGPVRAVDDVSFAFDAGTLN |
| Ga0207667_122527841 | 3300025949 | Corn Rhizosphere | LSAIVVENVSKHWTTPAGMVRAVEGLSFSLDAGTL |
| Ga0207712_111587371 | 3300025961 | Switchgrass Rhizosphere | VSAIAVESVSKHWTTADGRVRAVDGVSFRFAEGTLNVLL |
| Ga0207640_111905121 | 3300025981 | Corn Rhizosphere | VSAILAENLSKHWATAEGEVRAVDHVTFAFDEGTLNV |
| Ga0207658_110276511 | 3300025986 | Switchgrass Rhizosphere | VSAIAVENVSKHWTTPSGQVRAVDAISFELAAGTFN |
| Ga0207703_110085671 | 3300026035 | Switchgrass Rhizosphere | VSAIAVENVSKHWTTADGSVRAVDGVSFRFAEGTLNVL |
| Ga0207703_123420772 | 3300026035 | Switchgrass Rhizosphere | VSAIVAANVSKHWTTAEGKVCAVDALSFAFDPGTLNVL |
| Ga0207641_114707151 | 3300026088 | Switchgrass Rhizosphere | VSAIVVEGASKHWTTGDGQVRAVDRISFALDEGTLNV |
| Ga0207648_111217262 | 3300026089 | Miscanthus Rhizosphere | VSAIVAEGIAKHWTTADGDVRAVDGLSFAFERGTLNVLLGPTGC |
| Ga0207676_101626591 | 3300026095 | Switchgrass Rhizosphere | VSAIAAENVSKHWTTADGNVRAVDGLSFEFDEGTLN |
| Ga0209863_100678042 | 3300026281 | Prmafrost Soil | VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTF |
| Ga0209156_104866871 | 3300026547 | Soil | VSAIAVENVAKHWTTAAGQVRAVDGLSFALEEGTLNVLLGPSGC |
| Ga0209814_101766351 | 3300027873 | Populus Rhizosphere | VSAIAVENVSKHWTTAEGQVRAVDGLSFALDEGTLNVLL |
| Ga0209254_100448521 | 3300027897 | Freshwater Lake Sediment | VSAIAVENVSKHWSTADGNVRAVDAISFALDPGTLNV |
| Ga0209254_111036401 | 3300027897 | Freshwater Lake Sediment | VSAIVAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVLLGP |
| Ga0209668_101415253 | 3300027899 | Freshwater Lake Sediment | VAAIVVEGASKHWTTAEGQVRAVDSISFSLDEGTLN |
| Ga0209391_102071312 | 3300027975 | Freshwater Sediment | VSAISLRRVSKHWTTPQGQVQAVSDLSFDLEPGTLNVLL |
| Ga0268264_106003191 | 3300028381 | Switchgrass Rhizosphere | VSAIVVEGASKHWATGDGQVRAVDRLSFALDEGTLNVLL |
| Ga0302291_103151581 | 3300028865 | Fen | VSVIAVENVSKHWTTADGQVRAVDAISFELAAGTFNVLL |
| Ga0311334_102438313 | 3300029987 | Fen | VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFNVL |
| Ga0311336_100761584 | 3300029990 | Fen | VSAIAVENVSKHWTTATAQVRAVDNVSFALDAGTLNVLLGPS |
| Ga0311336_100838214 | 3300029990 | Fen | VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFN |
| Ga0302272_12064101 | 3300030001 | Bog | VSAIAVENVSKHWTTADGQVRAVDAISFDLAQGTFNV |
| Ga0311350_115223321 | 3300030002 | Fen | VSAIVVENISKHWTTSDGQVRAVDAISFDLAAGTFNVLLGP |
| Ga0311335_110739831 | 3300030838 | Fen | VSAIAVENVSKHWTTADGQVRAVDAISFELAAGTFNV |
| Ga0311366_117955462 | 3300030943 | Fen | VSAIAAEYVSKHWTTAAGEVRAVDGLSFAFDEGTLNV |
| Ga0265331_1000418512 | 3300031250 | Rhizosphere | VSAIIAEGVSKHWTTTEGDVRAVDGLSFAFEPGTLNVL |
| Ga0307468_1005597441 | 3300031740 | Hardwood Forest Soil | VSAIAVENVSKHWATAEGQVRAVDALSFAFDEGTLNVLLG |
| Ga0310904_103872952 | 3300031854 | Soil | VSAIAVDNVSKHWSTADGQVRAVDGVSFSLAEGTLNVLLGPSG |
| Ga0315297_102094233 | 3300031873 | Sediment | VSAIAVEDVSKHWTTADGQVRAVDAISFELAAGTFN |
| Ga0315297_104033483 | 3300031873 | Sediment | VSAIAVESVSKHWTTADGQVRAVDAISFELAAGTFNV |
| Ga0302322_1002303093 | 3300031902 | Fen | MVSAIAVENVSKHWTTADGRVHAVDAISFALEPGTLNVLLGPSG |
| Ga0302322_1016103641 | 3300031902 | Fen | VSAIAAENVSKHWTTADGEVRAVDGLSFAFDEGTLNVLL |
| Ga0310891_103487152 | 3300031913 | Soil | MSAIAAERVSKIWASAEGPVRAVDDVSFAFDAGTLNV |
| Ga0308174_107800232 | 3300031939 | Soil | VSAIAVDNVSKHWSTADGHVRAVDGISFSLAEGTLNV |
| Ga0310916_103045201 | 3300031942 | Soil | MSAIALDRVSKHWTTAGGKVHAVDDLTFAFEPGTLNVLLGPS |
| Ga0315278_109083972 | 3300031997 | Sediment | VSAIAAENISKHWTTADGEVRAVDRLSFAFDEGTLNV |
| Ga0318575_102448862 | 3300032055 | Soil | VSAIAVENVSKHWTTAEGQVRAVDALSFSLDEGTFNVLLGPS |
| Ga0308173_111470281 | 3300032074 | Soil | MSAIAAEHVSKVWATGAAPVRAVDDVSFAFDAGTLNVLL |
| Ga0315292_103657481 | 3300032143 | Sediment | VSAIAVEKVSKHWTTADGRVRAVDAISFALDPGTLNVLLGPSG |
| Ga0315292_115082012 | 3300032143 | Sediment | MESVIVSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVL |
| Ga0315283_100958291 | 3300032164 | Sediment | VSAIVAENLSKRWTTADGDVRAVDGVSFAFDEGTL |
| Ga0315276_122854021 | 3300032177 | Sediment | VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLNVL |
| Ga0307471_1022717882 | 3300032180 | Hardwood Forest Soil | VSAIAVENISKHWTTAEGQVRAVDGLSFALDEGTLNV |
| Ga0307472_1007433961 | 3300032205 | Hardwood Forest Soil | VSAIVAEGISKHWTTADGEVRAVDGLSFAFDRGTLNVLLG |
| Ga0315287_110239452 | 3300032397 | Sediment | VSAIAAENVSKHWTTADGEVRAVDRLSFAFDEGTLN |
| Ga0315275_126461192 | 3300032401 | Sediment | VSAIAAENVSKHWTTAEGQVRAVDGLSFAFDKGTLNVLLGP |
| Ga0315273_107042441 | 3300032516 | Sediment | VSAIAVEDVSKHWTTADGQVRAVDAISFELAAGTFNVL |
| Ga0315273_119547492 | 3300032516 | Sediment | VSAIAAENVSKHWMTAEGEVRAVDRLSFAFDEGTLNVLLGPSGCGK |
| Ga0335085_110384922 | 3300032770 | Soil | LSAIAAENVSKHWTTAEGEVRAVDRLSFAFDAGTLNVLLGPSG |
| Ga0316605_102966313 | 3300033408 | Soil | MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGP |
| Ga0310810_102923271 | 3300033412 | Soil | MSAIVAENLSKHWATADGEVRAVDGITFAFDEGTLN |
| Ga0316603_107910681 | 3300033413 | Soil | VSAIVAENLSKHWTTADGEVRAVDGLSFAFDEGTLNVLLGP |
| Ga0316603_114644101 | 3300033413 | Soil | VSAIAAEDVSKHWTTAEGKVHAVDGITFAFDEGTLNVLL |
| Ga0316629_113401351 | 3300033483 | Soil | MSAISLASVSKHWTTEQGRVQGVDGLSFELEPGTLNVLLGPSGCGK |
| Ga0316621_105896381 | 3300033488 | Soil | MSAIAAEGISKHWTTREGKVHAVDRLSFELEPGTL |
| Ga0326723_0018963_1_111 | 3300034090 | Peat Soil | MRPKGPSVSAIAAENISKHWTTADGQVRAVDGLSFAF |
| Ga0326723_0251735_239_388 | 3300034090 | Peat Soil | VSAIAVENLSKHWTTAEGQVRAVDGLSFALDEGTLNGPLGPSIRWSRVR |
| Ga0370493_0238648_2_112 | 3300034129 | Untreated Peat Soil | VSAITVENVSKHWTTSDGQVRAVDAISFELAAGTFNV |
| Ga0370497_0012755_1484_1624 | 3300034965 | Untreated Peat Soil | MARLAQQGEAVSAIAVENVSKHWTTAAGQVRAVDNVSFALEPGTLNV |
| ⦗Top⦘ |