Scaffold Ga0103268_1073729

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103268_1073729

Scaffold Ga0103268_1073729

Overview

Basic Information
Taxon OID	3300007192 Open in IMG/M
Scaffold ID	Ga0103268_1073729 Open in IMG/M
Source Dataset Name	Ant gut microbial communities from Cephalotes persimplex, Brazil
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Harvard University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	853
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Ant Gut → Cephalotes Ants Gut Microbiomes

Source Dataset Sampling Location
Location Name	CICRA, Madre de Dios, Peru
Coordinates	Lat. (^o)	-12.5	Long. (^o)	-70.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103268_10737293	F060965	N/A	MRYSLIDNVTLTLALLVTWLATNDTNNTLALDDFAVAANPLD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.