Scaffold Ga0104043_1098429

Overview

Basic Information

• Taxon OID: 3300007058
• Scaffold ID: Ga0104043_1098429
• Source Dataset Name: Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Cornell University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 723
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Drosophila Neotestacea Female Adult Gut → Drosophila Gut Microbial Communities From New York, Usa

Source Dataset Sampling Location

• Location Name: Mendon Ponds Park, Monroe County, NY, USA
• Coordinates
  • Lat. (^o): 43.025606
  • Long. (^o): -77.572811

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0104043_10984292	F060965	N/A	MRYSLINNVKLTLALFMTRFGANYTNYAMALDDLTVAADPLY*