Scaffold Ga0101570_10110299

Overview

Basic Information

• Taxon OID: 3300006626
• Scaffold ID: Ga0101570_10110299
• Source Dataset Name: Soil microbial communities from the Leymus chinensis steppe, China - after adding 17.5 g N m- 2, yr-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chengdu Institute of Biology, Chinese Academy of Sciences
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 808
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition

Source Dataset Sampling Location

• Location Name: the Inner Mongolia Grassland Ecosystem Research Station (IMGERS), China
• Coordinates
  • Lat. (^o): 43.63
  • Long. (^o): 116.7
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067705	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101570_101102992	F067705	AGG	MRVKAIAVLVIVAVSAGLFLAMHQENRADAAAGNCYMATDGPSTPTICQ*