| Basic Information | |
|---|---|
| Family ID | F067705 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MRVKAIAFLIIVAASAAAFVALRGENRADAAEGNCYSAASGPSTPTICS |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.26 % |
| % of genes near scaffold ends (potentially truncated) | 17.60 % |
| % of genes from short scaffolds (< 2000 bps) | 65.60 % |
| Associated GOLD sequencing projects | 73 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (60.800 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (16.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (48.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (71.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.96% β-sheet: 0.00% Coil/Unstructured: 61.04% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF08818 | DUF1801 | 46.40 |
| PF01812 | 5-FTHF_cyc-lig | 14.40 |
| PF11003 | DUF2842 | 8.00 |
| PF16338 | AGL_N | 3.20 |
| PF00456 | Transketolase_N | 2.40 |
| PF07486 | Hydrolase_2 | 2.40 |
| PF00232 | Glyco_hydro_1 | 2.40 |
| PF12833 | HTH_18 | 2.40 |
| PF13802 | Gal_mutarotas_2 | 1.60 |
| PF00753 | Lactamase_B | 0.80 |
| PF03734 | YkuD | 0.80 |
| PF00903 | Glyoxalase | 0.80 |
| PF12681 | Glyoxalase_2 | 0.80 |
| PF02800 | Gp_dh_C | 0.80 |
| PF05164 | ZapA | 0.80 |
| PF13202 | EF-hand_5 | 0.80 |
| PF07238 | PilZ | 0.80 |
| PF13545 | HTH_Crp_2 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 46.40 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 46.40 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 46.40 |
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 14.40 |
| COG0021 | Transketolase | Carbohydrate transport and metabolism [G] | 2.40 |
| COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 2.40 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 2.40 |
| COG3959 | Transketolase, N-terminal subunit | Carbohydrate transport and metabolism [G] | 2.40 |
| COG0057 | Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG3027 | Cell division protein ZapA, inhibits GTPase activity of FtsZ | Cell cycle control, cell division, chromosome partitioning [D] | 0.80 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.80 % |
| Unclassified | root | N/A | 39.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_105671482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1586 | Open in IMG/M |
| 3300001979|JGI24740J21852_10033061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1647 | Open in IMG/M |
| 3300001990|JGI24737J22298_10029392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1723 | Open in IMG/M |
| 3300003321|soilH1_10200987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1213 | Open in IMG/M |
| 3300003324|soilH2_10174122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1393 | Open in IMG/M |
| 3300004114|Ga0062593_100300323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1367 | Open in IMG/M |
| 3300004463|Ga0063356_101642920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 958 | Open in IMG/M |
| 3300004480|Ga0062592_102471972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 522 | Open in IMG/M |
| 3300005093|Ga0062594_100268531 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1266 | Open in IMG/M |
| 3300005175|Ga0066673_10361871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 847 | Open in IMG/M |
| 3300005327|Ga0070658_10000966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 24638 | Open in IMG/M |
| 3300005327|Ga0070658_10036726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3949 | Open in IMG/M |
| 3300005327|Ga0070658_10127128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2122 | Open in IMG/M |
| 3300005327|Ga0070658_10275897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1430 | Open in IMG/M |
| 3300005327|Ga0070658_10496979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1053 | Open in IMG/M |
| 3300005327|Ga0070658_10540520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1008 | Open in IMG/M |
| 3300005329|Ga0070683_100211258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1843 | Open in IMG/M |
| 3300005331|Ga0070670_100491205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1091 | Open in IMG/M |
| 3300005336|Ga0070680_100003668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 11466 | Open in IMG/M |
| 3300005336|Ga0070680_100087250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2580 | Open in IMG/M |
| 3300005336|Ga0070680_100118463 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2209 | Open in IMG/M |
| 3300005336|Ga0070680_101153206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 670 | Open in IMG/M |
| 3300005339|Ga0070660_100627894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 899 | Open in IMG/M |
| 3300005341|Ga0070691_10558079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 670 | Open in IMG/M |
| 3300005344|Ga0070661_100121607 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1956 | Open in IMG/M |
| 3300005344|Ga0070661_100620944 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 875 | Open in IMG/M |
| 3300005344|Ga0070661_101142721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 650 | Open in IMG/M |
| 3300005435|Ga0070714_102200893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 537 | Open in IMG/M |
| 3300005451|Ga0066681_10634984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 655 | Open in IMG/M |
| 3300005455|Ga0070663_100909562 | Not Available | 760 | Open in IMG/M |
| 3300005458|Ga0070681_11432755 | Not Available | 615 | Open in IMG/M |
| 3300005466|Ga0070685_11237844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 568 | Open in IMG/M |
| 3300005539|Ga0068853_100262416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1588 | Open in IMG/M |
| 3300005539|Ga0068853_101507569 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 651 | Open in IMG/M |
| 3300005542|Ga0070732_10956066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 524 | Open in IMG/M |
| 3300005548|Ga0070665_100447141 | Not Available | 1302 | Open in IMG/M |
| 3300005563|Ga0068855_100155555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2598 | Open in IMG/M |
| 3300005578|Ga0068854_102293741 | Not Available | 500 | Open in IMG/M |
| 3300005614|Ga0068856_100224365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1894 | Open in IMG/M |
| 3300005616|Ga0068852_100171206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2036 | Open in IMG/M |
| 3300005618|Ga0068864_100227112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1725 | Open in IMG/M |
| 3300006626|Ga0101570_10110299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 808 | Open in IMG/M |
| 3300006755|Ga0079222_10101868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1511 | Open in IMG/M |
| 3300006804|Ga0079221_10356877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 886 | Open in IMG/M |
| 3300006804|Ga0079221_10696863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 706 | Open in IMG/M |
| 3300006893|Ga0073928_10429604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 960 | Open in IMG/M |
| 3300009545|Ga0105237_12777406 | Not Available | 501 | Open in IMG/M |
| 3300010375|Ga0105239_11713171 | Not Available | 728 | Open in IMG/M |
| 3300010396|Ga0134126_10416222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1559 | Open in IMG/M |
| 3300012212|Ga0150985_105989633 | Not Available | 857 | Open in IMG/M |
| 3300013100|Ga0157373_11120958 | Not Available | 591 | Open in IMG/M |
| 3300013102|Ga0157371_10042774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 3228 | Open in IMG/M |
| 3300013102|Ga0157371_10755766 | Not Available | 730 | Open in IMG/M |
| 3300013102|Ga0157371_11131052 | Not Available | 601 | Open in IMG/M |
| 3300013104|Ga0157370_10312318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1450 | Open in IMG/M |
| 3300013105|Ga0157369_11756831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 630 | Open in IMG/M |
| 3300013307|Ga0157372_12785915 | Not Available | 561 | Open in IMG/M |
| 3300014487|Ga0182000_10279315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 685 | Open in IMG/M |
| 3300020070|Ga0206356_11846278 | Not Available | 514 | Open in IMG/M |
| 3300020070|Ga0206356_11869657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2753 | Open in IMG/M |
| 3300020081|Ga0206354_11586500 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2017 | Open in IMG/M |
| 3300020082|Ga0206353_10157697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1054 | Open in IMG/M |
| 3300022557|Ga0212123_10485441 | Not Available | 806 | Open in IMG/M |
| 3300024055|Ga0247794_10325111 | Not Available | 522 | Open in IMG/M |
| 3300025321|Ga0207656_10046161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1868 | Open in IMG/M |
| 3300025904|Ga0207647_10061432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2293 | Open in IMG/M |
| 3300025904|Ga0207647_10069060 | Not Available | 2137 | Open in IMG/M |
| 3300025907|Ga0207645_10651425 | Not Available | 716 | Open in IMG/M |
| 3300025909|Ga0207705_10156500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1710 | Open in IMG/M |
| 3300025909|Ga0207705_10360204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1122 | Open in IMG/M |
| 3300025909|Ga0207705_10387055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1081 | Open in IMG/M |
| 3300025909|Ga0207705_10405617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1054 | Open in IMG/M |
| 3300025909|Ga0207705_11439178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 523 | Open in IMG/M |
| 3300025912|Ga0207707_10044863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3853 | Open in IMG/M |
| 3300025917|Ga0207660_10008189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 6763 | Open in IMG/M |
| 3300025920|Ga0207649_10040404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2835 | Open in IMG/M |
| 3300025929|Ga0207664_10206781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1697 | Open in IMG/M |
| 3300025929|Ga0207664_11803621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 534 | Open in IMG/M |
| 3300025931|Ga0207644_11155088 | Not Available | 651 | Open in IMG/M |
| 3300025944|Ga0207661_10098783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2447 | Open in IMG/M |
| 3300025944|Ga0207661_10789345 | Not Available | 874 | Open in IMG/M |
| 3300025944|Ga0207661_10890698 | Not Available | 820 | Open in IMG/M |
| 3300025945|Ga0207679_11911402 | Not Available | 541 | Open in IMG/M |
| 3300025981|Ga0207640_10796002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 819 | Open in IMG/M |
| 3300025981|Ga0207640_12024228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
| 3300026067|Ga0207678_11846189 | Not Available | 528 | Open in IMG/M |
| 3300026078|Ga0207702_12080546 | Not Available | 558 | Open in IMG/M |
| 3300026078|Ga0207702_12448492 | Not Available | 509 | Open in IMG/M |
| 3300026118|Ga0207675_101681293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 655 | Open in IMG/M |
| 3300026550|Ga0209474_10226806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1172 | Open in IMG/M |
| 3300027750|Ga0209461_10009376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1646 | Open in IMG/M |
| 3300027766|Ga0209796_10039776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1412 | Open in IMG/M |
| 3300027766|Ga0209796_10070008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1064 | Open in IMG/M |
| 3300027766|Ga0209796_10140416 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 755 | Open in IMG/M |
| 3300028587|Ga0247828_10972243 | Not Available | 552 | Open in IMG/M |
| 3300031474|Ga0170818_108784388 | Not Available | 554 | Open in IMG/M |
| 3300031548|Ga0307408_100485544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1078 | Open in IMG/M |
| 3300031824|Ga0307413_10030598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3026 | Open in IMG/M |
| 3300031938|Ga0308175_101139974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 866 | Open in IMG/M |
| 3300031938|Ga0308175_102743238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 551 | Open in IMG/M |
| 3300031939|Ga0308174_10079538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2301 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 16.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 13.60% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 12.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 4.00% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.40% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.40% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.80% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Host-Associated | Open in IMG/M |
| 3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300003848 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300006626 | Soil microbial communities from the Leymus chinensis steppe, China - after adding 17.5 g N m- 2, yr-1 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027766 | Agave microbial communities from Guanajuato, Mexico - Or.Sf.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1056714824 | 3300000364 | Soil | MRVRAIAIVVILAVSAALFVAVRSASRADAAGGNCYSDATGPTTPQICD* |
| JGI24740J21852_100330611 | 3300001979 | Corn Rhizosphere | DSHPGVFMRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| JGI24737J22298_100293923 | 3300001990 | Corn Rhizosphere | TCKQSGGADSHPGVFMRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| soilH1_101517362 | 3300003321 | Sugarcane Root And Bulk Soil | GGGLTRTGVLAMRIKAIAGVIIVALSAAAFVAMRAENRADAAKGDCYAADQGPSTPTICS |
| soilH1_102009872 | 3300003321 | Sugarcane Root And Bulk Soil | MRVKSIAVVIIVAASAAVFLAMHQENRADAAAGNCYMAEQGPSSPTICQ* |
| soilH2_101741222 | 3300003324 | Sugarcane Root And Bulk Soil | MRVKSIAVVIIVAASAAFYLAMHQESRADAAAGNCYMAEQGPSTPTICQ* |
| Ga0058694_10505192 | 3300003848 | Agave | VRVKAIAFLVIVAASGAAFYVMHADNRADAAKGDCYAADSGPSTPTICG* |
| Ga0062593_1003003233 | 3300004114 | Soil | MRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| Ga0063356_1004376252 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MFRMRGRAIAGLVIVALSAVAFVAMRAENRANAAKGDCYAADKGPATPTICS* |
| Ga0063356_1016429202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRVKAITFLVVLAISAALVVAMRSENRADAAGGNCYASPQGPSAPTICE* |
| Ga0062592_1024719722 | 3300004480 | Soil | MRVKAITFIVVLAISAALFVAMRSENRADAAGGNCYASPQGPSAPTICE* |
| Ga0062594_1002685312 | 3300005093 | Soil | MRVKAIGFLIIVAASAAALVATRYESRADAAGGNCYSDAPGPSTPTICS* |
| Ga0066673_103618713 | 3300005175 | Soil | MRVRAMAMVMVVALSAALFVAMRMENRADAAAGNCYSATQGPSTPTVCN* |
| Ga0070658_1000096626 | 3300005327 | Corn Rhizosphere | MLTCKQSGGADSHPGVFMRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| Ga0070658_100367264 | 3300005327 | Corn Rhizosphere | MRVKAIAFLIIVAASAAIFVAERQESRADAANGNCYSAASGPATPTICS* |
| Ga0070658_101271282 | 3300005327 | Corn Rhizosphere | MRAKAIAVLVIVAASAGLFLAMHQENRADAAAGNCYMATDGPSTPTICQ* |
| Ga0070658_102758972 | 3300005327 | Corn Rhizosphere | VLFTNVAALLRRIRGLAMRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPSTPTICS* |
| Ga0070658_104969792 | 3300005327 | Corn Rhizosphere | MRVKSIAVVIIVAASAAFYLAMHQESRADAAAGNCYMADQGPSTPTICQ* |
| Ga0070658_105405202 | 3300005327 | Corn Rhizosphere | MRVKSIAVVIIVAASAALFLAMHQENRADAAAGNCYMADQGPASPTICQ* |
| Ga0070658_106774191 | 3300005327 | Corn Rhizosphere | MRVKAIAGLVIVAVSAAAFIAMRAENRADAAKGDCYAAEKGPATPTICG* |
| Ga0070683_1002112582 | 3300005329 | Corn Rhizosphere | MRVKAIAFLIIVAASAAAFVALRGENRADAAEGNCYSAASGPSTPTICS* |
| Ga0070670_1004912051 | 3300005331 | Switchgrass Rhizosphere | MRVKAIAVFVVIAASAALFVGMRSNSRADAAATDCYASAKGPSTPTICE* |
| Ga0070666_111523782 | 3300005335 | Switchgrass Rhizosphere | ALVIVALSAAAFVAMRAENRAGAASADCYAADNGPAKPTICE* |
| Ga0070680_1000036685 | 3300005336 | Corn Rhizosphere | VRILAIDKGSHRGLAMRVKVIAFLIIVAASAAAFLAFRSENRADAAGGNCYSAAAGPSTPTICS* |
| Ga0070680_1000872502 | 3300005336 | Corn Rhizosphere | VRFLAIDKGSHRGFAMRVKAIAFLIIIAGSAAAFVALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0070680_1001184634 | 3300005336 | Corn Rhizosphere | MRLKAIAILIIVAGSAAAFVVFRSEDRADAAGGNCYSAASGPSTPTICS* |
| Ga0070680_1011532061 | 3300005336 | Corn Rhizosphere | MRVKAIAFLIIVAASAAAFFAFRSENRADAAGGNCYSAASGPSTPTICS* |
| Ga0070660_1006278941 | 3300005339 | Corn Rhizosphere | MRVKAIAVLIIVAVSGAAFMAMRYESRADAAAGDCYAAAQGPSTPTICQ* |
| Ga0070691_105580792 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKAIAFLIIIAGSAAAFVALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0070661_1001216072 | 3300005344 | Corn Rhizosphere | VRCLAIDKGSHRGFAMRVKAIAFLIIIAGSAAAFMALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0070661_1006209441 | 3300005344 | Corn Rhizosphere | FLAIDKGSHRRLAMRVKAIAFLIIVAASAAAFVALRGENRADAAEGNCYSAASGPSTPTICS* |
| Ga0070661_1011427212 | 3300005344 | Corn Rhizosphere | MRVKSIAVVIIVAASAALFLAMHQDNRADAAAGNCYMADQGPSTPTICQ* |
| Ga0070709_105040912 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIKAIAVLIIVAVSAAAFVAMRRESRADAARGNCYSAPQGPSTPQICD* |
| Ga0070714_1001624565 | 3300005435 | Agricultural Soil | MRIKAIAVLIIVAVSAAAFVAMRRESRADAAAGNCYSAPKGPSTPQICD* |
| Ga0070714_1001643352 | 3300005435 | Agricultural Soil | VRVKAIAFLIIAAVTGAAFLAMRGENRADAAKGDCYAADSGPSTPTICS* |
| Ga0070714_1022008931 | 3300005435 | Agricultural Soil | MRVKAIAFLLVVAVSATLFVVMRGENRADAAGGNCYSAAQGPSTPTICS* |
| Ga0066681_106349842 | 3300005451 | Soil | MRVRAMAMVVVVALSAALFVAMRMENRADAAAGNCYSATQGPSTPTVCN* |
| Ga0070663_1009095621 | 3300005455 | Corn Rhizosphere | VLFTNVAALLRRIRGLAMRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPATPTICS* |
| Ga0070681_114327551 | 3300005458 | Corn Rhizosphere | RGLAMRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPSTPTICS* |
| Ga0070681_120020612 | 3300005458 | Corn Rhizosphere | MRVKAIAGLIIVALSAAAFIAMRAENRADAAAGDCYAADQGPSTPTICQ* |
| Ga0070685_112378441 | 3300005466 | Switchgrass Rhizosphere | MRVKPIAVVVIVAASAALFVAMQHENRAGAANGNCYMADSGPSTPTICN* |
| Ga0070679_1003159253 | 3300005530 | Corn Rhizosphere | MRTKAIAGLVIVAVSAVAFVAMRAENRANAAKGDCYTAEKGPATPTICG* |
| Ga0070679_1013916641 | 3300005530 | Corn Rhizosphere | MRVKAIAGLVIVAVSAAAFIAMRAENRADAAKGDCYAAEKGPATATICG* |
| Ga0068853_1002624162 | 3300005539 | Corn Rhizosphere | MRVKSIAVVIIVAASAVFYLAMHQESRADAAAGNCYMADQGPSTPTICQ* |
| Ga0068853_1015075692 | 3300005539 | Corn Rhizosphere | MRVKAIAFLIIIAGSAAAFMALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0070732_109560662 | 3300005542 | Surface Soil | MRIRSIAVLIIVAVSATAFVAIRRESRADAAGGNCYSAPQGPSTPQICD* |
| Ga0070693_1003914502 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKAITGLVIVALSAAAFVALRAESRADAAKGDCYAADQGPSTPTICQ* |
| Ga0070665_1004471411 | 3300005548 | Switchgrass Rhizosphere | MRVKAIAVLIVVAVSAGLFVLFHDSSRADAAGGDCYSDAAGPSTPQICN* |
| Ga0068855_1000873262 | 3300005563 | Corn Rhizosphere | MRVKAIAVLIIVAVSAAAFVAMRRENRADAAGGNCYSAPQGPATPQICD* |
| Ga0068855_1001555552 | 3300005563 | Corn Rhizosphere | MRVKVIAFLIIVAASAAAFLAFRSENRADAAGGNCYSAAAGPSTPTICS* |
| Ga0070664_1015667831 | 3300005564 | Corn Rhizosphere | GGGLTRTGVLAMRIKAIAGVVIVALSAAAFVAMRAENRADAAKGDCYAADQGPSTPTICS |
| Ga0068854_1022937411 | 3300005578 | Corn Rhizosphere | MRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGP |
| Ga0068856_1002243653 | 3300005614 | Corn Rhizosphere | VVFTKVAALLRRKRGLAMRVKAIAVLVIVAASAVIFVAERQGSRADAANGNCYSDASGPSTPTICS* |
| Ga0068852_1001712061 | 3300005616 | Corn Rhizosphere | RVKVIAFLIIVAASAAAFLAFRSENRADAAGGNCYSAAAGPSTPTICS* |
| Ga0068864_1002271123 | 3300005618 | Switchgrass Rhizosphere | GVFMRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| Ga0101570_101102992 | 3300006626 | Soil | MRVKAIAVLVIVAVSAGLFLAMHQENRADAAAGNCYMATDGPSTPTICQ* |
| Ga0079222_101018682 | 3300006755 | Agricultural Soil | MRVKPIAVMVIVAASAALFVAMQHENRADAANGNCYMADSGPTTPTICN* |
| Ga0079221_103568772 | 3300006804 | Agricultural Soil | MRVKPIAVMVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN* |
| Ga0079221_106968632 | 3300006804 | Agricultural Soil | MRVKAIAFLIIVAASGAAFFAMRAENRADAANGNCYSDAAGPSTPTICS* |
| Ga0073928_104296043 | 3300006893 | Iron-Sulfur Acid Spring | MRIKAIAFLIVVAVSAAAFVAIRHESRADAAGGNCYSAPQGPSTPQICD* |
| Ga0105237_127774061 | 3300009545 | Corn Rhizosphere | VKSIAVVIIVAASAAFYLAMHQESRADAAAGNCYMADQGPSTPTICQ* |
| Ga0105239_117131712 | 3300010375 | Corn Rhizosphere | MRVKSIAVVIIVAASAALFLAMHQENRADAAAGNCYMTDQGPASPTICQ* |
| Ga0134126_104162221 | 3300010396 | Terrestrial Soil | LAIDKGSHRGFAMRVKAIAFLIIIAGSAAAFMALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0150985_1059896331 | 3300012212 | Avena Fatua Rhizosphere | MRTKSIAVVIIVAASAALFVAMHHDNRADAAAGNCYSDAAGPSTPTICQ* |
| Ga0157373_111209582 | 3300013100 | Corn Rhizosphere | MRVKAIGFLIIVAASAAAFVATRYENRADAAGGNCYSDAAGPSTPTICS* |
| Ga0157371_100427747 | 3300013102 | Corn Rhizosphere | RILAIDKGSHRGFAMRVKAIAFLIIIAGSAAAFMALRSENRADAAGGNCYSSAAGPSTPTICS* |
| Ga0157371_107557662 | 3300013102 | Corn Rhizosphere | MRVKAIGFLIIVAATAAAFVATRYESRADAAGGNCYADAPGPSTPTICS* |
| Ga0157371_111310521 | 3300013102 | Corn Rhizosphere | MRVKAIAFLIIVAASAAAFIAFRSENRADAAGGNCYSAAAGPSTPTICS* |
| Ga0157370_103123181 | 3300013104 | Corn Rhizosphere | LTRTGVTPMRVKSIAVVIIVAASAVFYLAMHQESRADAAAGNCYMADQGPSTPTICQ* |
| Ga0157370_106232401 | 3300013104 | Corn Rhizosphere | MRVKAIAVLVIVAVSAAAFVAMRRENRADAAGGNCYSAPQGPATPQICD* |
| Ga0157369_117568312 | 3300013105 | Corn Rhizosphere | MRVKQIAVVIIVAASAAVFLAMHQENRADAAAGNCYMADQGPSSPTICQ* |
| Ga0157372_127859151 | 3300013307 | Corn Rhizosphere | MRVKAIGFLIIVAASAAAFVATRYENRADAAGGNCYSAAAGPSTPTICS* |
| Ga0182000_102793152 | 3300014487 | Soil | MRVKAIAFLIIVAATGAAFFALRSESRADAASGDCYAADQGPTTPTICS* |
| Ga0206356_118462781 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | RCRGLAMRVKAIAFLIIVAASAAIFVAERQESRADAANGNCYSAASGPATPTICS |
| Ga0206356_118696575 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKAIAFLIIIAGSAAAFMALRSENRADAAGGNCYSSAAGPSTPTICS |
| Ga0206354_115865002 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VLFTNVAALLRRIRGLAMRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPSTPTICS |
| Ga0206353_101576971 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | MRVKAIAFLIIVAASAAIFVAERQESRADAANGNCYSAASGPATPTICS |
| Ga0212123_104854412 | 3300022557 | Iron-Sulfur Acid Spring | MRIKAIAFLIVVAVSAAAFVAIRHESRADAAGGNCYSAPQGPSTPQICD |
| Ga0247794_103251111 | 3300024055 | Soil | DSHPGVFMRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN |
| Ga0207656_100461613 | 3300025321 | Corn Rhizosphere | MRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMADSGPSTPTICN |
| Ga0207682_100901952 | 3300025893 | Miscanthus Rhizosphere | MFRMRGRAIAGLVIVALSAVAFVAMRAENRANAAKGDCYAADKGPATPTICS |
| Ga0207647_100614323 | 3300025904 | Corn Rhizosphere | MRVKSIAVVIIVAASAVFYLAMHQESRADAAAGNCYMADQGPSTPTICQ |
| Ga0207647_100690602 | 3300025904 | Corn Rhizosphere | MRVKAIGFLIIVAASAAALVATRYESRADAAGGNCYSDAPGPSTPTICS |
| Ga0207699_107836662 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MRIKAIAVLIIVAVSAAAFVAMRRESRADAARGNCYSAPQGPSTPQICD |
| Ga0207645_106514251 | 3300025907 | Miscanthus Rhizosphere | MRVKPIAVVVIVAASAALFVAMQHENRADAANGNCYMVDSGPSTPTICN |
| Ga0207705_101565002 | 3300025909 | Corn Rhizosphere | MRAKAIAVLVIVAASAGLFLAMHQENRADAAAGNCYMATDGPSTPTICQ |
| Ga0207705_103602043 | 3300025909 | Corn Rhizosphere | MRVKSIAVVIIVAASAAFYLAMHQESRADAAAGNCYMADQGPSTPTICQ |
| Ga0207705_103870552 | 3300025909 | Corn Rhizosphere | MRVKSIAVVIIVAASAALFLAMHQENRADAAAGNCYMADQGPASPTICQ |
| Ga0207705_104056173 | 3300025909 | Corn Rhizosphere | MRVKAIAVLIVVAVSAGLFVLFHDSSRADAAGGDCYSDAAGPSTPQICN |
| Ga0207705_114391782 | 3300025909 | Corn Rhizosphere | MRVKAIAFLIIVAASAALFVAERQESRADAAGGNCYTDAQGPTTPTICS |
| Ga0207707_100448637 | 3300025912 | Corn Rhizosphere | MRVKAIAFLIIIAGSAAAFVALRSENRADAAGGNCYSSAAGPSTPTICS |
| Ga0207707_101542423 | 3300025912 | Corn Rhizosphere | LVIVALSAAAFVAMRAENRAGAASADCYAADNGPAKPTICE |
| Ga0207660_100081894 | 3300025917 | Corn Rhizosphere | MRLKAIAILIIVAGSAAAFVVFRSEDRADAAGGNCYSAASGPSTPTICS |
| Ga0207660_116601901 | 3300025917 | Corn Rhizosphere | AGLVIVAVSAVAFVAMRAENRANAAKGDCYTAEKGPATPTICG |
| Ga0207649_100404044 | 3300025920 | Corn Rhizosphere | MRVKSIAVVIIVAASAALFLAMHQENRADAAAGNCYASAQGPSSPTICE |
| Ga0207664_102067812 | 3300025929 | Agricultural Soil | VVFTKVAALLRRKRGLAMRVKAIAVLVIVAASAVIFVAERQGSRADAANGNCYSDASGPSTPTICS |
| Ga0207664_118036212 | 3300025929 | Agricultural Soil | MRVKAIAFLIIVAGSAAAFVVLRSENRADAAGGNCYSAAAGPSTPTICS |
| Ga0207644_111550882 | 3300025931 | Switchgrass Rhizosphere | MRTKSIAVVIIVAASAALFVAMHHENRADAAGGNCYSDAAGPSTPTICQ |
| Ga0207661_100987836 | 3300025944 | Corn Rhizosphere | MRVKAIAFLIIVAASAAAFVALRGENRADAAEGNCYSAASGPSTPTICS |
| Ga0207661_107893451 | 3300025944 | Corn Rhizosphere | MRVKAIAFLIIVAASAAIFVAERQESRADAANGNCYSAASG |
| Ga0207661_108906981 | 3300025944 | Corn Rhizosphere | MRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPST |
| Ga0207679_119114022 | 3300025945 | Corn Rhizosphere | TPMRVKSIAVVIIVAASAAFYLAMHQESRADAAAGNCYMADQGPSTPTICQ |
| Ga0207640_107960022 | 3300025981 | Corn Rhizosphere | VLFTNVAALLRRIRGLAMRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASGPATPTICS |
| Ga0207640_120242281 | 3300025981 | Corn Rhizosphere | MRVKAITFLVVLAISAALVVAMRSENRADAAGGNCYASPQGPSAP |
| Ga0207678_118461891 | 3300026067 | Corn Rhizosphere | GLAMRVKAIAVLVIVAASAVIFVAERQGSRADAANGNCYSDASGPSTPTICS |
| Ga0207702_120805462 | 3300026078 | Corn Rhizosphere | MRVKAIAVLVIVAASAAVFVAERQGSRADAANGNCYSDASG |
| Ga0207702_124484921 | 3300026078 | Corn Rhizosphere | GLTRSGVTQMRVKQIAVVIIVAASAAVFLAMHQENRADAAAGNCYMADQGPSSPTICQ |
| Ga0207674_100277549 | 3300026116 | Corn Rhizosphere | MRIKAIAGVVIVALSAAAFVAMRAENRADAAKGDCYAADQGPSTPTICS |
| Ga0207675_1016812931 | 3300026118 | Switchgrass Rhizosphere | MRVKAITFLVVLAISAALVVAMRSENRADAAGGNCYASPQGPSAPTICE |
| Ga0209474_102268063 | 3300026550 | Soil | MRVRAMAMVMVVALSAALFVAMRMENRADAAAGNCYSATQGPSTPTVCN |
| Ga0209461_100093762 | 3300027750 | Agave | MRVKGFALLVIVALSAAAFVAVRSANRADAAGGNCYSEAAGPSTPTICN |
| Ga0209796_100397762 | 3300027766 | Agave | MRVKAIAFLIIVAASGAAFYAMRAENRADAANGNCYSDASGPATPTICS |
| Ga0209796_100700082 | 3300027766 | Agave | MRVKAIAFLIIVAASGAAFFAMRAENRADAANANCYSDAAGPSTPTICS |
| Ga0209796_101404161 | 3300027766 | Agave | KGLAMRVKAIAFLVIVAATGAAFVALRGENRADAANGNCYADSQGPATPTICG |
| Ga0209796_102834392 | 3300027766 | Agave | VRVKAIAFLVIVAASGAAFYVMHADNRADAAKGDCYAADSGPSTPTICG |
| Ga0247828_109722432 | 3300028587 | Soil | MRVKAIAVFVVIAASAALFVGMRSNSRADAAATDCYASAKGPSTPTICE |
| Ga0268240_101608061 | 3300030496 | Soil | MRGKAIAVALILGLSAAAFVAMRAENRADAASGNCYSEAAGPNTPTICS |
| Ga0170818_1087843881 | 3300031474 | Forest Soil | AAGVPMRIRAVAVLIIVAVSATAFVAIRRESRADAAGGNCYSAQQGPSTPQICD |
| Ga0307408_1004855442 | 3300031548 | Rhizosphere | MRVKAITVLVVLAISAALIVAMRSENRADAAGGNCYASPQGPSAPTICE |
| Ga0307413_100305983 | 3300031824 | Rhizosphere | MRVKAIAVLVVIAASAALFVAMRGNSRADAAASDCYASAQGPSTPTICE |
| Ga0310900_105739052 | 3300031908 | Soil | MFRMRRRAIAGLVIVALSAVAFVAMRAENRANAAKGDCYAADKGPATPTICS |
| Ga0308175_1011399742 | 3300031938 | Soil | MRVKAIAVLIVVAVSAGLFVLLHDSSRADAAGGDCYSDAAGPSTPQICN |
| Ga0308175_1027432381 | 3300031938 | Soil | MRVKVIAGLIIVAASAALFVALRQESRADAAAGNCYAAAQGPSTPTICG |
| Ga0308174_100795385 | 3300031939 | Soil | MRVKAIAFLIIVAGSAAAFLALRSENRADAAVGNCYSAAAGPSTPTICS |
| Ga0307415_1010544852 | 3300032126 | Rhizosphere | MRVKAITFLVVLAISAALVVAMRSENRADAAGGNCYASPQ |
| ⦗Top⦘ |