| Basic Information | |
|---|---|
| Taxon OID | 3300006623 Open in IMG/M |
| Scaffold ID | Ga0101568_10076199 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from the Leymus chinensis steppe, China - after adding 5.25 g N m- 2, yr-1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Chengdu Institute of Biology, Chinese Academy of Sciences |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 738 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From The Leymus Chinensis Steppe, China - Nitrogen Deposition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | the Inner Mongolia Grassland Ecosystem Research Station | |||||||
| Coordinates | Lat. (o) | 43.63 | Long. (o) | 116.7 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F102100 | Metagenome / Metatranscriptome | 102 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0101568_100761991 | F102100 | GGAGG | MTLLGLAGVLAGFVLTALARARKLGDSWESAGLWAIFGGFG |
| ⦗Top⦘ |