Scaffold Ga0100240_111112

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0100240_111112

Scaffold Ga0100240_111112

Overview

Basic Information
Taxon OID	3300006483 Open in IMG/M
Scaffold ID	Ga0100240_111112 Open in IMG/M
Source Dataset Name	Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Agriculture and Agri-Food Canada
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1009
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure → Microbial Communities From Manure Storage Tank From Sherbrooke, Qc, Canada

Source Dataset Sampling Location
Location Name	Sherbrooke, QC, Canada
Coordinates	Lat. (^o)	45.4	Long. (^o)	-71.9	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033483	Metagenome / Metatranscriptome	177	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0100240_1111121	F033483	N/A	VTPGDACVALDIDGLPVVLVLPERDAELIMWPYWANRILQEGRGDE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.