Scaffold Ga0081425_131042

Overview

Basic Information

• Taxon OID: 3300006065
• Scaffold ID: Ga0081425_131042
• Source Dataset Name: Hotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, Mini-Metagenomics
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Stanford University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 136948
• Total Scaffold Genes: 171
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 14 (8.19%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales (Source: IMG-VR)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring → Mini-Metagenome - Microbial Communities From The Yellowstone National Park

Source Dataset Sampling Location

• Location Name: Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.564833
  • Long. (^o): -110.86325

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103256	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081425_13104223	F103256	N/A	MEYKKGQLDEILFLIKRGFSYGDIMSMPVYERRYFVQYIIELENSK*