| Basic Information | |
|---|---|
| Family ID | F103256 |
| Family Type | Metagenome |
| Number of Sequences | 101 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MEYKKGQLDEILFLVKKGFSYGDILTMPVYLRRYYVDYIIELENK |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.00 % |
| % of genes near scaffold ends (potentially truncated) | 48.51 % |
| % of genes from short scaffolds (< 2000 bps) | 70.30 % |
| Associated GOLD sequencing projects | 75 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.70 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (57.426 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (11.881 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.564 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.337 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.21% β-sheet: 0.00% Coil/Unstructured: 54.79% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.70 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF06841 | Phage_T4_gp19 | 4.95 |
| PF03796 | DnaB_C | 1.98 |
| PF00176 | SNF2-rel_dom | 1.98 |
| PF04965 | GPW_gp25 | 0.99 |
| PF07282 | OrfB_Zn_ribbon | 0.99 |
| PF04984 | Phage_sheath_1 | 0.99 |
| PF02086 | MethyltransfD12 | 0.99 |
| PF13482 | RNase_H_2 | 0.99 |
| PF03420 | Peptidase_S77 | 0.99 |
| PF02739 | 5_3_exonuc_N | 0.99 |
| COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 1.98 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 1.98 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.99 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.99 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.99 |
| COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 64.36 % |
| Unclassified | root | N/A | 35.64 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000032|Draft_c0419451 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 601 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107057285 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2846 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_107603748 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 913 | Open in IMG/M |
| 3300001765|MIS_1001106 | Not Available | 62208 | Open in IMG/M |
| 3300001851|RCM31_10376449 | Not Available | 560 | Open in IMG/M |
| 3300002220|MLSBCLC_10460236 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1188 | Open in IMG/M |
| 3300002371|B570J29602_1006557 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 681 | Open in IMG/M |
| 3300002408|B570J29032_109512134 | Not Available | 825 | Open in IMG/M |
| 3300002408|B570J29032_109686361 | Not Available | 1056 | Open in IMG/M |
| 3300002835|B570J40625_100000708 | Not Available | 58074 | Open in IMG/M |
| 3300002835|B570J40625_100134900 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2878 | Open in IMG/M |
| 3300002835|B570J40625_100709481 | Not Available | 899 | Open in IMG/M |
| 3300003429|JGI25914J50564_10138218 | Not Available | 589 | Open in IMG/M |
| 3300003820|Ga0007863_1008131 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1037 | Open in IMG/M |
| 3300004126|Ga0066179_10052786 | Not Available | 951 | Open in IMG/M |
| 3300004240|Ga0007787_10002422 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 6746 | Open in IMG/M |
| 3300004481|Ga0069718_13703106 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 692 | Open in IMG/M |
| 3300005527|Ga0068876_10000013 | All Organisms → Viruses → Varidnaviria → Bamfordvirae → Nucleocytoviricota → Megaviricetes → Imitervirales → Mimiviridae | 155713 | Open in IMG/M |
| 3300005662|Ga0078894_10023627 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 5006 | Open in IMG/M |
| 3300005662|Ga0078894_10224810 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1700 | Open in IMG/M |
| 3300005662|Ga0078894_11513849 | Not Available | 556 | Open in IMG/M |
| 3300005935|Ga0075125_10359591 | Not Available | 567 | Open in IMG/M |
| 3300006065|Ga0081425_131042 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 136948 | Open in IMG/M |
| 3300006484|Ga0070744_10006570 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3487 | Open in IMG/M |
| 3300006484|Ga0070744_10209976 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 553 | Open in IMG/M |
| 3300007603|Ga0102921_1221516 | Not Available | 679 | Open in IMG/M |
| 3300007617|Ga0102897_1223191 | Not Available | 561 | Open in IMG/M |
| 3300008107|Ga0114340_1000587 | Not Available | 50235 | Open in IMG/M |
| 3300008107|Ga0114340_1041196 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2064 | Open in IMG/M |
| 3300008107|Ga0114340_1113169 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
| 3300008110|Ga0114343_1071843 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1268 | Open in IMG/M |
| 3300008113|Ga0114346_1177351 | Not Available | 878 | Open in IMG/M |
| 3300008113|Ga0114346_1178300 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 874 | Open in IMG/M |
| 3300008267|Ga0114364_1017453 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 3064 | Open in IMG/M |
| 3300008267|Ga0114364_1084087 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1033 | Open in IMG/M |
| 3300008950|Ga0102891_1165060 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 652 | Open in IMG/M |
| 3300009026|Ga0102829_1045906 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1304 | Open in IMG/M |
| 3300009151|Ga0114962_10013389 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 5971 | Open in IMG/M |
| 3300009152|Ga0114980_10151758 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1373 | Open in IMG/M |
| 3300009159|Ga0114978_10106663 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
| 3300009693|Ga0116141_10239533 | Not Available | 982 | Open in IMG/M |
| 3300010157|Ga0114964_10612602 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 511 | Open in IMG/M |
| 3300010885|Ga0133913_12370251 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1300 | Open in IMG/M |
| 3300010885|Ga0133913_12370252 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1300 | Open in IMG/M |
| 3300012012|Ga0153799_1059050 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 699 | Open in IMG/M |
| (restricted) 3300013123|Ga0172368_10518025 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 517 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10021311 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 4600 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10855195 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 510 | Open in IMG/M |
| (restricted) 3300013129|Ga0172364_10042913 | Not Available | 3305 | Open in IMG/M |
| 3300013372|Ga0177922_10439404 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 592 | Open in IMG/M |
| 3300013372|Ga0177922_11061070 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 792 | Open in IMG/M |
| (restricted) 3300014720|Ga0172376_10535680 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 650 | Open in IMG/M |
| 3300017754|Ga0181344_1120852 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 755 | Open in IMG/M |
| 3300020074|Ga0194113_10003261 | Not Available | 21828 | Open in IMG/M |
| 3300020141|Ga0211732_1538039 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 698 | Open in IMG/M |
| 3300020151|Ga0211736_10176022 | All Organisms → Viruses → Predicted Viral | 2135 | Open in IMG/M |
| 3300020159|Ga0211734_10426874 | Not Available | 524 | Open in IMG/M |
| 3300020159|Ga0211734_10706139 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1571 | Open in IMG/M |
| 3300020159|Ga0211734_10706488 | Not Available | 990 | Open in IMG/M |
| 3300020160|Ga0211733_10023584 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 13152 | Open in IMG/M |
| 3300020160|Ga0211733_10944732 | Not Available | 692 | Open in IMG/M |
| 3300020161|Ga0211726_11038057 | Not Available | 594 | Open in IMG/M |
| 3300020172|Ga0211729_10187877 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1240 | Open in IMG/M |
| 3300020183|Ga0194115_10417953 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 571 | Open in IMG/M |
| 3300020198|Ga0194120_10047975 | All Organisms → Viruses → Predicted Viral | 3439 | Open in IMG/M |
| 3300020214|Ga0194132_10605157 | Not Available | 525 | Open in IMG/M |
| 3300020527|Ga0208232_1008671 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1606 | Open in IMG/M |
| 3300020527|Ga0208232_1024561 | Not Available | 845 | Open in IMG/M |
| 3300020722|Ga0214245_1063322 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 500 | Open in IMG/M |
| 3300021961|Ga0222714_10000069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 120740 | Open in IMG/M |
| 3300021962|Ga0222713_10311577 | Not Available | 998 | Open in IMG/M |
| 3300023184|Ga0214919_10013998 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 9638 | Open in IMG/M |
| 3300024346|Ga0244775_10218450 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1595 | Open in IMG/M |
| 3300024348|Ga0244776_10001818 | Not Available | 22211 | Open in IMG/M |
| 3300025389|Ga0208257_1005830 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2259 | Open in IMG/M |
| 3300027212|Ga0208554_1029814 | Not Available | 881 | Open in IMG/M |
| 3300027281|Ga0208440_1060144 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 818 | Open in IMG/M |
| 3300027593|Ga0255118_1086984 | Not Available | 504 | Open in IMG/M |
| 3300027608|Ga0208974_1062049 | Not Available | 1051 | Open in IMG/M |
| 3300027749|Ga0209084_1000079 | Not Available | 94382 | Open in IMG/M |
| 3300027782|Ga0209500_10426474 | Not Available | 527 | Open in IMG/M |
| 3300027798|Ga0209353_10194843 | Not Available | 890 | Open in IMG/M |
| 3300027896|Ga0209777_10144686 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1966 | Open in IMG/M |
| 3300027896|Ga0209777_10591458 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 805 | Open in IMG/M |
| 3300028027|Ga0247722_10002957 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 8584 | Open in IMG/M |
| 3300031707|Ga0315291_10847737 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 789 | Open in IMG/M |
| 3300031746|Ga0315293_10111022 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2318 | Open in IMG/M |
| 3300031746|Ga0315293_10348780 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1176 | Open in IMG/M |
| 3300031772|Ga0315288_10763058 | Not Available | 900 | Open in IMG/M |
| 3300031772|Ga0315288_10775434 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 890 | Open in IMG/M |
| 3300031786|Ga0315908_10575208 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 937 | Open in IMG/M |
| 3300031857|Ga0315909_10108872 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2370 | Open in IMG/M |
| 3300032046|Ga0315289_11450251 | Not Available | 528 | Open in IMG/M |
| 3300032053|Ga0315284_10739512 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 1148 | Open in IMG/M |
| 3300032164|Ga0315283_11133947 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 820 | Open in IMG/M |
| 3300033418|Ga0316625_100018334 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 2720 | Open in IMG/M |
| 3300034018|Ga0334985_0443858 | Not Available | 764 | Open in IMG/M |
| 3300034061|Ga0334987_0009420 | Not Available | 9159 | Open in IMG/M |
| 3300034082|Ga0335020_0219546 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 947 | Open in IMG/M |
| 3300034082|Ga0335020_0626741 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 501 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 11.88% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 10.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 8.91% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.92% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 7.92% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.93% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 6.93% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.96% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.96% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.97% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.98% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 1.98% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.98% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.99% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.99% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.99% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.99% |
| Hotspring | Environmental → Aquatic → Thermal Springs → Near-Boiling (>90C) → Alkaline → Hotspring | 0.99% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.99% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.99% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.99% |
| Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001765 | Sinkhole freshwater microbial communities from Lake Huron, USA - combined 2007-2012 | Environmental | Open in IMG/M |
| 3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
| 3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300002371 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005935 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN | Environmental | Open in IMG/M |
| 3300006065 | Hotspring Microbial Communities from Lower Geyser Basin, Spring Unknown 43 (Mound Spring), Yellowstone National Park, Wyoming, USA ? Sample 3, Mini-Metagenomics | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007617 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
| 3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
| 3300020214 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80m | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020722 | Freshwater microbial communities from Trout Bog Lake, WI - 23OCT2008 hypolimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025389 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 (SPAdes) | Environmental | Open in IMG/M |
| 3300027212 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027281 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027593 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_04194512 | 3300000032 | Hydrocarbon Resource Environments | LKLVSGSNFFALSTDYNKGQLDEILYLIKKGFSYKDILTMPVYLRRYFVGYLLELEKQN* |
| JGIcombinedJ13530_1070572852 | 3300001213 | Wetland | MEYREGQLKEILFLIREGFSYNDVLSMPVYIRKYYIDYIIEMKNK* |
| JGIcombinedJ13530_1076037482 | 3300001213 | Wetland | MDYKRTQLKELLFLVKRGFSYSDVISMPVYIRRYYIQYIAEAEKE* |
| MIS_100110625 | 3300001765 | Sinkhole Freshwater | MDYKKGQLDEILFMVKRGFSYSDVLMMPIHTRRYYVQYMIELENK* |
| RCM31_103764492 | 3300001851 | Marine Plankton | NFFALSTEYKKAQLDEILFMVKNGFSYGDILNMPVYLRRYYINFILEAQKT* |
| MLSBCLC_104602362 | 3300002220 | Hydrocarbon Resource Environments | MDYKKGQLDEILYLIKRGFSYSETLTMPVYLRRYFVQYLIELENSK* |
| B570J29602_10065572 | 3300002371 | Freshwater | MEYRKTQLDEFLYLIKKGXNYSELLTMPIYLRRYYVNYIIEIENKQ* |
| B570J29032_1095121341 | 3300002408 | Freshwater | ELGLGLTFFALSTEYKKNQLSEIHYLIRKGFSYGDILTMPVYIRRYYIGYIMELENTQ* |
| B570J29032_1096863611 | 3300002408 | Freshwater | FFVLSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLVELENKK* |
| B570J40625_1000007085 | 3300002835 | Freshwater | MEYRKTQLDEFLYLIKKGFNYSELLTMPIYLRRYYVNYIIEIENKQ* |
| B570J40625_1000309421 | 3300002835 | Freshwater | PRQETQSKLKLDSGLSFFVLSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLVELENKK* |
| B570J40625_1001349002 | 3300002835 | Freshwater | MDYKKGQLDEILFLIKKGFSYGDLLTMPVHLRRYYVNYIIELENNTQ* |
| B570J40625_1007094811 | 3300002835 | Freshwater | DYKKGQLDEILYLVKRGFSYGDILSMPIYIRRYYINYMMELENNTQ* |
| JGI25914J50564_101382182 | 3300003429 | Freshwater Lake | FFVLSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLIELENKK* |
| Ga0007863_10081312 | 3300003820 | Freshwater | MDYKKIQLDEILFLVKKGFSYGDILTMPVYLRRYYVEYIIELENKQS* |
| Ga0066179_100527862 | 3300004126 | Freshwater Lake | DYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLIELENKK* |
| Ga0007787_100024224 | 3300004240 | Freshwater Lake | MLKSASGWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK* |
| Ga0069718_137031062 | 3300004481 | Sediment | MSQLKEILFLVKRGFSYSDLLSMPVYIRRYYIQYIQELENQPKN* |
| Ga0068876_100000134 | 3300005527 | Freshwater Lake | MAYKKGQLDEILFLIKRGFSYGDIITMPVFIRRYYVEYIIELENTPK* |
| Ga0078894_100236271 | 3300005662 | Freshwater Lake | ASGWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK* |
| Ga0078894_102248102 | 3300005662 | Freshwater Lake | FFVLSTDYKKGQLDEILFLVKKGFSYGDILTMPVYLRKYYVGYIIELENAK* |
| Ga0078894_115138491 | 3300005662 | Freshwater Lake | ASGWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFVRRYYVEYILELENSPK* |
| Ga0075125_103595911 | 3300005935 | Saline Lake | GWNFFALSTEYRKGQLDEILFLVKRGFSYSDIISMPIYIRRYYVEYIHELETAN* |
| Ga0081425_13104223 | 3300006065 | Hotspring | MEYKKGQLDEILFLIKRGFSYGDIMSMPVYERRYFVQYIIELENSK* |
| Ga0070744_100065702 | 3300006484 | Estuarine | MEYKKGQLDEILFLVKKGFSYGDILTMPVYLRRYYVDYIIELENKTT* |
| Ga0070744_102099762 | 3300006484 | Estuarine | MEYRKTQLDEFLFLIKKGFNYSELLTMPIYLRRYYVNYIIEIENKQ* |
| Ga0102921_12215162 | 3300007603 | Estuarine | MEYKKGQLDEILFLIKKGFSYGDLLTMPVHLRRYYVNYIIELENNTQ* |
| Ga0102897_12231911 | 3300007617 | Estuarine | KGQLDEFLFLIKRGFTYGDILTMPIWERRYYVNYLIELENKQ* |
| Ga0114340_100058725 | 3300008107 | Freshwater, Plankton | MDYKKGQLDEILFLIKKGFTYGDILTMPVFIRRYYVGYILEMENTPK* |
| Ga0114340_10411962 | 3300008107 | Freshwater, Plankton | GWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK* |
| Ga0114340_11131691 | 3300008107 | Freshwater, Plankton | SKGQLDEILYLVKRGFSYRDILLMPIYIRRYYINYMIEVENTPK* |
| Ga0114343_10718432 | 3300008110 | Freshwater, Plankton | MDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK* |
| Ga0114346_11773512 | 3300008113 | Freshwater, Plankton | QLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK* |
| Ga0114346_11783002 | 3300008113 | Freshwater, Plankton | MDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELE |
| Ga0114364_10174532 | 3300008267 | Freshwater, Plankton | MAYKKGQLDEILFLIKRGFSYGDIITMPVFIRRYYVEYIIELENAPK* |
| Ga0114364_10840872 | 3300008267 | Freshwater, Plankton | MEYKKGQLDEILFLIKKGFSYGDVLTMPIFIRRYYVEYIIELENTPK* |
| Ga0102891_11650602 | 3300008950 | Estuarine | MEYKKGQLDEILFLVKKGFSYGDILTMPVYLRRYYVDYIIELENK |
| Ga0102829_10459062 | 3300009026 | Estuarine | NQLTEILFLVKRGFSYGDIMSMPVYVRKYFISFMMELENSN* |
| Ga0114962_100133893 | 3300009151 | Freshwater Lake | MDYKKGQLDEILFLVKRGFSYGDILSMPVYIRRYYINYMIEKETENN* |
| Ga0114980_101517582 | 3300009152 | Freshwater Lake | MEYKKGQLDEILFLVKKGFSYGDILTMPIYLRRYYVDYIIELENTKT* |
| Ga0114978_101066632 | 3300009159 | Freshwater Lake | FFVLSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLIELENKQ* |
| Ga0116141_102395332 | 3300009693 | Anaerobic Digestor Sludge | KLDLGSNFFALSTDYRTGQLKEILFLIKRGFTYSDVLSMPIHVRRFYIQYISEIETQK* |
| Ga0114964_106126021 | 3300010157 | Freshwater Lake | MEYKKGQLDEILFLVKKGFSYGDILTMPVYLRRYY |
| Ga0133913_123702512 | 3300010885 | Freshwater Lake | LGLTFFALSTDYKKNQLDEILYLITKGFTYGDVLTMPIFVRRYYINFLIEKQTENS* |
| Ga0133913_123702522 | 3300010885 | Freshwater Lake | LGLTFFALSTDYKKNQLDEILYLITKGFTYGDVLTMPIFVRRYYINFLIEKQTENG* |
| Ga0153799_10590502 | 3300012012 | Freshwater | MDYKKGQLDEILFLIKKGFSYGDIITMPVFIRRYYVEYIIELENAPK* |
| (restricted) Ga0172368_105180252 | 3300013123 | Freshwater | MEYKKYQLDEILFLVKRGFSYSDIISMPVHTRKYYVSYIIELENG* |
| (restricted) Ga0172365_100213113 | 3300013127 | Sediment | MGQLKEILFLVKRGFSYSDILSMPIYVRRYYIQYITELETEK* |
| (restricted) Ga0172365_108551952 | 3300013127 | Sediment | MEYKKGQLDEILFLVKRGFSYSDILAMPIYIRRYFVEYMIELQNEK* |
| (restricted) Ga0172364_100429131 | 3300013129 | Sediment | MGQLKEILFLVKRGFSYSDILSMPIYVRRYYIQYITELESEK* |
| Ga0177922_104394042 | 3300013372 | Freshwater | MEYKKGQLDEILFLIKKGFSYGDIITMPVFIRRYYVEYIIELENAPK* |
| Ga0177922_110610701 | 3300013372 | Freshwater | MEYRKTQLDEFLFLIKKGFNYSELLTMPIYLRRYY |
| (restricted) Ga0172376_105356802 | 3300014720 | Freshwater | MEYKKGQLDEILFLIKKGFSYGDVLTMPIFIRRYYVEYILELENSPK* |
| Ga0181344_11208522 | 3300017754 | Freshwater Lake | MSMLKSASGWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSPK |
| Ga0194113_100032615 | 3300020074 | Freshwater Lake | MAYKKGQLDEILFLIKRGFSYGDIITMPVFIRRYYVEYIIELENAPK |
| Ga0211732_15380392 | 3300020141 | Freshwater | MEYKKGQLDEILFLVKKGFSYGDILTMPVYLRRYYVDYIIELENKTT |
| Ga0211736_101760221 | 3300020151 | Freshwater | LQLGLGLTFFALSTEYKKNQLSEIHYLVKKGFSYGDILTMPVYIRRYYIGYIMEMENPN |
| Ga0211734_104268741 | 3300020159 | Freshwater | QLDEILYLVKRGFSYRDILLMPIYIRRYYINYLIEIENTPR |
| Ga0211734_107061391 | 3300020159 | Freshwater | DSGLSFFVLSTDYKKGQLDEILFLVKRGFSYGDILSMPVYIRRYYIQYLISLESGNN |
| Ga0211734_107064882 | 3300020159 | Freshwater | DSGLSFFVLSTDYKKGQLDEILFLVKRGFSYGDILSMPVYIRRYYIQYLISLENGNN |
| Ga0211733_100235841 | 3300020160 | Freshwater | NQLTEILFLVKRGFSYGDIMSMPVYVRKYFISFMMELENSN |
| Ga0211733_109447321 | 3300020160 | Freshwater | SFFDLSTEYKRGQLNEILYLVKKGFSYGDIVSMPIYIRRYYVEFLLELENSN |
| Ga0211726_110380571 | 3300020161 | Freshwater | NQLSEIHYLVKKGFSYGDILTMPVYIRRYYIGYIMEMENPN |
| Ga0211729_101878772 | 3300020172 | Freshwater | KKGQLDEILFLVKRGFSYGDILSMPVYIRRYYIQYLISLEGGND |
| Ga0194115_104179532 | 3300020183 | Freshwater Lake | MEYKKGQLDEILFLIKKGFSYGDVLTMPIFIRRYYVEYILELENSPK |
| Ga0194120_100479751 | 3300020198 | Freshwater Lake | QLDEILFLIKRGFSYGDIITMPVFIRRYYVEYIIELENAPK |
| Ga0194132_106051572 | 3300020214 | Freshwater Lake | LSTDYKKGQLDEILFLVKRGFSYGDILNMPVYLRRYYVSYLIELENSPK |
| Ga0208232_10086712 | 3300020527 | Freshwater | MEYRKTQLDEFLYLIKKGFNYSELLTMPIYLRRYYVNYIIEIENKQ |
| Ga0208232_10245611 | 3300020527 | Freshwater | SNLELGLGLTFFALSTEYKKNQLSEIHYLIRKGFSYGDILTMPVYIRRYYIGYIMELENT |
| Ga0214245_10633221 | 3300020722 | Freshwater | MDYKKGQLDEILFLVKRGFSYSDIISMPVHIRRYFVEYLIE |
| Ga0222714_10000069107 | 3300021961 | Estuarine Water | MLKSASGWSFFVLSMDYKKGQLDEILFLIKKGFSYGDILTMPIFIRRYYVEYILELENSP |
| Ga0222713_103115772 | 3300021962 | Estuarine Water | STDYSKGQLDEILFLVKRGFSYRDILLMPVYIRRYYISYLIELENNNK |
| Ga0214919_100139984 | 3300023184 | Freshwater | MKSNLILGSGLTFFALSTEYKKNQLSEILFLVKRGFSYGDIISMPIYIRRYYIEYIMELENS |
| Ga0244775_102184501 | 3300024346 | Estuarine | MEYKKGQLDEILFLIKKGFSYGDLLTMPVHLRRYYVNYIIELENNTQ |
| Ga0244776_100018184 | 3300024348 | Estuarine | MDYKKGQLDEILFLIKKGFSYGDLLTMPVHLRRYYVNYIIELENNTQ |
| Ga0208257_10058302 | 3300025389 | Freshwater | MDYKKIQLDEILFLVKKGFSYGDILTMPVYLRRYYVEYIIELENKQS |
| Ga0208554_10298142 | 3300027212 | Estuarine | LGLGLTFFALSTEYKKNQLSEIHYLVKKGFSYGDILTMPVYIRRYYIGYIMEMENPN |
| Ga0208440_10601442 | 3300027281 | Estuarine | MEYRKTQLDEFLFLIKKGFNYSELLTMPIYLRRYYVNYIIEIENKQ |
| Ga0255118_10869842 | 3300027593 | Freshwater | LSTEYRKGMLDEILYLVRRGFSYNDILTMPVYVRRYYINYIMEIESPN |
| Ga0208974_10620492 | 3300027608 | Freshwater Lentic | NFFALSTEYRKTQLDEILFLIKRGFSYGDILSMPISIRRYYVNYIMELENSKN |
| Ga0209084_100007969 | 3300027749 | Freshwater Lake | MDYKKGQLDEILFLVKRGFSYGDILSMPVYIRRYYINYMIEKETENN |
| Ga0209500_104264741 | 3300027782 | Freshwater Lake | LSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLIELENKQ |
| Ga0209353_101948432 | 3300027798 | Freshwater Lake | ILFLVKRGFSYSDIISMPVYIRRYYVQYMLELEGGNN |
| Ga0209777_101446862 | 3300027896 | Freshwater Lake Sediment | MDYKKGQLNEILYLVKRGFSYSDIISMPVYIRRYFIQYISELENEK |
| Ga0209777_105914582 | 3300027896 | Freshwater Lake Sediment | MDYKKGQLDEILFLVKRGFSYSDIISMPVHIRRYFVEYLIEIENRK |
| Ga0247722_100029575 | 3300028027 | Deep Subsurface Sediment | KLKLGSGLSFFVLSTDYKKGQLDEFLFLIKRGFTYGDILTMPVWERRYYVNYLIELENKK |
| Ga0315291_108477372 | 3300031707 | Sediment | MEYRKGQLDEILYLIKRGFTYSDIISMPVFIRRYYVQYINELENVK |
| Ga0315293_101110223 | 3300031746 | Sediment | DLGRNFFALSMDYKKNQLDEILFLVNRHFSYSDIISMPVYLRRYFRDYILELENKE |
| Ga0315293_103487802 | 3300031746 | Sediment | MDYKKGQLDEILFLIKRGFAYRDILLMPISIRRYYVNYIYGLENTPA |
| Ga0315288_107630582 | 3300031772 | Sediment | MEYRKGQLKEILFLVKRGFSYLDIISMPVYIRRYYVQYIQELENEK |
| Ga0315288_107754342 | 3300031772 | Sediment | MDYKKNQLDEILFLVNRHFSYSDIISMPVYLRRYFRDYILELENKE |
| Ga0315908_105752081 | 3300031786 | Freshwater | MAYKKGQLDEILFLIKRGFSYGDIITMPVFIRRYYVEYIIELEN |
| Ga0315909_101088721 | 3300031857 | Freshwater | GQLDEILYLVKRGFSYRDILLMPIYIRRYYINYLIEIENTPK |
| Ga0315289_114502512 | 3300032046 | Sediment | RESQLKEIFMLVKRGFSYGDILVMPIFVRRYYFNYIIEQENKK |
| Ga0315284_107395122 | 3300032053 | Sediment | MEYREGQLKEILFLIREGFSYNDVLSMPVYIRKYYIDYIIEMKNK |
| Ga0315283_111339472 | 3300032164 | Sediment | MEYRKGQLDEILYLIKRGFSYSDIISMPVHIRRYFIQYLTELENSK |
| Ga0316625_1000183342 | 3300033418 | Soil | MDYRMGQLKEILFLVKRGFSYSDILTMPVYIRRYYIQYIVELENQK |
| Ga0334985_0443858_622_762 | 3300034018 | Freshwater | TEYKKNQLSEIHYLIRKGFSYGDILTMPVYIRRYYIGYIMELENTQ |
| Ga0334987_0009420_1166_1309 | 3300034061 | Freshwater | MEYKKGQLDEILFLVKKGFSYGDIITMPVFIRRYYVEYIIELENAPK |
| Ga0335020_0219546_824_946 | 3300034082 | Freshwater | MDYKKGQLDEILFLIKKGFSYGDLLTMPVHLRRYYVNYIIE |
| Ga0335020_0626741_366_500 | 3300034082 | Freshwater | MEYRKTQLDEFLYLIKKGFNYSELLTMPIYLRRYYVNYIIEIENK |
| ⦗Top⦘ |