Scaffold Ga0081201_120589

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0081201_120589

Scaffold Ga0081201_120589

Overview

Basic Information
Taxon OID	3300006061 Open in IMG/M
Scaffold ID	Ga0081201_120589 Open in IMG/M
Source Dataset Name	Microbial communities from petroleum pipeline sediment, Khambat, Gujarat, India
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Anand Agricultural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	565
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment → Microbial Communities From Petroleum Pipeline Sediment, Khambat, Gujarat, India

Source Dataset Sampling Location
Location Name	Khambat, Gujarat, India
Coordinates	Lat. (^o)	22.172778	Long. (^o)	72.983333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105852	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0081201_1205892	F105852	GGAGG	MAHDEEPLLANPPSAEAAYHVRDYERFTKLLKYGAIICFIIGFLVVLIIS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.