Basic Information | |
---|---|
Family ID | F105852 |
Family Type | Metagenome |
Number of Sequences | 100 |
Average Sequence Length | 50 residues |
Representative Sequence | MAHEEEPLLAHPPTQEVAVHVRDYERFTKLFKYGALTCLVIGFVVLLILK |
Number of Associated Samples | 81 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 76.00 % |
% of genes near scaffold ends (potentially truncated) | 38.00 % |
% of genes from short scaffolds (< 2000 bps) | 89.00 % |
Associated GOLD sequencing projects | 76 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (100.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere (14.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.59% β-sheet: 0.00% Coil/Unstructured: 56.41% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF05222 | AlaDh_PNT_N | 47.00 |
PF00072 | Response_reg | 16.00 |
PF00158 | Sigma54_activat | 10.00 |
PF01266 | DAO | 4.00 |
PF00106 | adh_short | 1.00 |
PF04073 | tRNA_edit | 1.00 |
PF01894 | UPF0047 | 1.00 |
PF00809 | Pterin_bind | 1.00 |
PF02954 | HTH_8 | 1.00 |
PF11967 | RecO_N | 1.00 |
PF01408 | GFO_IDH_MocA | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886011|MRS1b_contig_6013010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 876 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100538122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1285 | Open in IMG/M |
3300000955|JGI1027J12803_107846004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 667 | Open in IMG/M |
3300004114|Ga0062593_100058798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2457 | Open in IMG/M |
3300004156|Ga0062589_102587270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 526 | Open in IMG/M |
3300004463|Ga0063356_100850636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1280 | Open in IMG/M |
3300004463|Ga0063356_100967255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1211 | Open in IMG/M |
3300004480|Ga0062592_100544604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 971 | Open in IMG/M |
3300005171|Ga0066677_10694528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 570 | Open in IMG/M |
3300005179|Ga0066684_10604125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 737 | Open in IMG/M |
3300005181|Ga0066678_10681104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 685 | Open in IMG/M |
3300005187|Ga0066675_11001658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 628 | Open in IMG/M |
3300005328|Ga0070676_10166563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1422 | Open in IMG/M |
3300005330|Ga0070690_100908471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 689 | Open in IMG/M |
3300005331|Ga0070670_100309318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1383 | Open in IMG/M |
3300005333|Ga0070677_10538817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 638 | Open in IMG/M |
3300005334|Ga0068869_100062056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2742 | Open in IMG/M |
3300005340|Ga0070689_100985626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 749 | Open in IMG/M |
3300005340|Ga0070689_100997135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 745 | Open in IMG/M |
3300005366|Ga0070659_101864758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 539 | Open in IMG/M |
3300005367|Ga0070667_101332491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 673 | Open in IMG/M |
3300005436|Ga0070713_102102041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 547 | Open in IMG/M |
3300005457|Ga0070662_100199674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1586 | Open in IMG/M |
3300005534|Ga0070735_10204507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1207 | Open in IMG/M |
3300005575|Ga0066702_10236828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1112 | Open in IMG/M |
3300005575|Ga0066702_10259452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1060 | Open in IMG/M |
3300005617|Ga0068859_100636147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1159 | Open in IMG/M |
3300005618|Ga0068864_102095061 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 572 | Open in IMG/M |
3300005764|Ga0066903_104381110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 754 | Open in IMG/M |
3300006061|Ga0081201_120589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 565 | Open in IMG/M |
3300006169|Ga0082029_1091666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3777 | Open in IMG/M |
3300006169|Ga0082029_1763978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 853 | Open in IMG/M |
3300006175|Ga0070712_100376229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1168 | Open in IMG/M |
3300006195|Ga0075366_10175446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1301 | Open in IMG/M |
3300006755|Ga0079222_12122080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 556 | Open in IMG/M |
3300006796|Ga0066665_11147220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 592 | Open in IMG/M |
3300006797|Ga0066659_11701682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 532 | Open in IMG/M |
3300006806|Ga0079220_12000402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 517 | Open in IMG/M |
3300006904|Ga0075424_100570802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1208 | Open in IMG/M |
3300006954|Ga0079219_12491670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 503 | Open in IMG/M |
3300009137|Ga0066709_101486542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 978 | Open in IMG/M |
3300009177|Ga0105248_12460227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
3300010044|Ga0126310_11505043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 552 | Open in IMG/M |
3300010366|Ga0126379_11388036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 808 | Open in IMG/M |
3300010396|Ga0134126_11822102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 667 | Open in IMG/M |
3300012202|Ga0137363_10713515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 849 | Open in IMG/M |
3300012210|Ga0137378_11386613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
3300012353|Ga0137367_10905512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 607 | Open in IMG/M |
3300012359|Ga0137385_11132548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 643 | Open in IMG/M |
3300013296|Ga0157374_12375537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 557 | Open in IMG/M |
3300013296|Ga0157374_12670010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 527 | Open in IMG/M |
3300013297|Ga0157378_12333149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 587 | Open in IMG/M |
3300013306|Ga0163162_10788173 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1068 | Open in IMG/M |
3300014487|Ga0182000_10110404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 938 | Open in IMG/M |
3300015371|Ga0132258_10022904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 13697 | Open in IMG/M |
3300015374|Ga0132255_101760444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 941 | Open in IMG/M |
3300017947|Ga0187785_10644522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 550 | Open in IMG/M |
3300018433|Ga0066667_11135002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 677 | Open in IMG/M |
3300018468|Ga0066662_10053774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2585 | Open in IMG/M |
3300018468|Ga0066662_10304721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1341 | Open in IMG/M |
3300018468|Ga0066662_12856977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 512 | Open in IMG/M |
3300025315|Ga0207697_10022714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2569 | Open in IMG/M |
3300025315|Ga0207697_10077360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1399 | Open in IMG/M |
3300025321|Ga0207656_10233029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 898 | Open in IMG/M |
3300025321|Ga0207656_10403486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 687 | Open in IMG/M |
3300025911|Ga0207654_10689641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 733 | Open in IMG/M |
3300025919|Ga0207657_10161221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1821 | Open in IMG/M |
3300025924|Ga0207694_10250307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1450 | Open in IMG/M |
3300025929|Ga0207664_10833929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 829 | Open in IMG/M |
3300025972|Ga0207668_11296870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 655 | Open in IMG/M |
3300025986|Ga0207658_11685655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 579 | Open in IMG/M |
3300026095|Ga0207676_10206594 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1739 | Open in IMG/M |
3300026116|Ga0207674_11739037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 591 | Open in IMG/M |
3300026116|Ga0207674_11888243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 563 | Open in IMG/M |
3300026118|Ga0207675_101584826 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
3300026118|Ga0207675_102725107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 502 | Open in IMG/M |
3300026142|Ga0207698_10300955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1493 | Open in IMG/M |
3300027750|Ga0209461_10037955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 942 | Open in IMG/M |
3300027750|Ga0209461_10092348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 676 | Open in IMG/M |
3300027986|Ga0209168_10097133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1522 | Open in IMG/M |
3300028889|Ga0247827_10077428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1604 | Open in IMG/M |
3300030496|Ga0268240_10150291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 574 | Open in IMG/M |
3300031548|Ga0307408_100034295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3554 | Open in IMG/M |
3300031548|Ga0307408_101272963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 688 | Open in IMG/M |
3300031548|Ga0307408_101574339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 623 | Open in IMG/M |
3300031731|Ga0307405_10043115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2750 | Open in IMG/M |
3300031731|Ga0307405_11978054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 521 | Open in IMG/M |
3300031824|Ga0307413_11392787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 616 | Open in IMG/M |
3300031852|Ga0307410_11482895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 597 | Open in IMG/M |
3300031858|Ga0310892_11261470 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 528 | Open in IMG/M |
3300031938|Ga0308175_101960597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 656 | Open in IMG/M |
3300031939|Ga0308174_10406538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1097 | Open in IMG/M |
3300031995|Ga0307409_100262948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1584 | Open in IMG/M |
3300031995|Ga0307409_101553776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 689 | Open in IMG/M |
3300031995|Ga0307409_101554485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 689 | Open in IMG/M |
3300032005|Ga0307411_10024066 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 3622 | Open in IMG/M |
3300032005|Ga0307411_10031670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3257 | Open in IMG/M |
3300032005|Ga0307411_10472797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1054 | Open in IMG/M |
3300032126|Ga0307415_100070317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2457 | Open in IMG/M |
3300033412|Ga0310810_11369219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 546 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 14.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.00% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.00% |
Agave | Host-Associated → Plants → Phyllosphere → Phylloplane/Leaf Surface → Unclassified → Agave | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Petroleum Sediment | Engineered → Industrial Production → Engineered Product → Unclassified → Unclassified → Petroleum Sediment | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006061 | Microbial communities from petroleum pipeline sediment, Khambat, Gujarat, India | Engineered | Open in IMG/M |
3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027750 | Agave microbial communities from Guanajuato, Mexico - As.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300030496 | Bulk soil microbial communities from Mexico - Penjamo (Pe) metaG (v2) | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MRS1b_0763.00001260 | 2162886011 | Miscanthus Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS |
INPhiseqgaiiFebDRAFT_1005381222 | 3300000364 | Soil | MAEEEPLLVSPPTQEVAAHVRDYERFTKLLKYGALXCLVIAFVVLLILK* |
JGI1027J12803_1078460043 | 3300000955 | Soil | MAEEEPLLVSPPTQEVAAHVRDYERFTKLLKYGALICLVI |
Ga0062593_1000587983 | 3300004114 | Soil | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS* |
Ga0062589_1025872702 | 3300004156 | Soil | MAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYGAIACLAIGFLVVLIIS* |
Ga0063356_1008506362 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAHDEEPLLAHPPTQEVAHHVHDYERFTKLLKYGAIACLIIAFLVLLIIT* |
Ga0063356_1009672552 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYEHFTKLLKYGAIACLVVAFIVIMLIS* |
Ga0062592_1005446041 | 3300004480 | Soil | MAHDEDPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS* |
Ga0066677_106945281 | 3300005171 | Soil | MAEEEPLLVSPPNQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG* |
Ga0066684_106041251 | 3300005179 | Soil | DRASKESFMAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG* |
Ga0066678_106811041 | 3300005181 | Soil | KPSTRRGLGRAASLVMDTPDRASKESLMAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWSFLTCLVIAFVVLLILKNG* |
Ga0066675_110016581 | 3300005187 | Soil | MAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG* |
Ga0070676_101665633 | 3300005328 | Miscanthus Rhizosphere | HMAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS* |
Ga0070690_1009084711 | 3300005330 | Switchgrass Rhizosphere | PLRDAKGEIMAHEEEPLLAHPPTQEVAVHVRDYERFTKLFKYGALTCLVIGFVVLLILK* |
Ga0070670_1003093182 | 3300005331 | Switchgrass Rhizosphere | MAHDEEPLLADPPSAEAAYHVQDYERFTKLLKYGALICLAIAFLVVMIIS* |
Ga0070677_105388172 | 3300005333 | Miscanthus Rhizosphere | LLAHPPTAEVAHHVEDYERFTKLLKYGAIACLAIGFLVVLIIS* |
Ga0068869_1000620561 | 3300005334 | Miscanthus Rhizosphere | KDMADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQIL* |
Ga0070689_1009856261 | 3300005340 | Switchgrass Rhizosphere | DAKGEIMAHEEEPLLAHPPTQEVAVHVRDYERFTKLFKYGALTCLVIGFVVLLILK* |
Ga0070689_1009971352 | 3300005340 | Switchgrass Rhizosphere | MADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQIL* |
Ga0070659_1018647581 | 3300005366 | Corn Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGALICLAIAFLVVMIIS* |
Ga0070667_1013324912 | 3300005367 | Switchgrass Rhizosphere | MAEEEPLLVSPPTQHVAVHVRDYVRFTKLLKWGALICLVIGFVVLLILK* |
Ga0070713_1021020412 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHEEEPLLASPPTQEMAAHVHDYERFTRMIKYGAIACLIVGFIVLLILK* |
Ga0070662_1001996742 | 3300005457 | Corn Rhizosphere | MAHEEEPLLAHPPTQEVAVHVRDYERFTKLFKYGALTCLVIGFVVLLILK* |
Ga0070735_102045072 | 3300005534 | Surface Soil | MAEEEEPLLASPPTQEVAVHVADYERFTRMLKLGAITCLIIGFIVLLILK* |
Ga0066702_102368282 | 3300005575 | Soil | MAEEEPLLVSPPTQDAAAHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG* |
Ga0066702_102594522 | 3300005575 | Soil | MAEEEPILVSPPTQEMAHHVADYARFTRMLKYGAFVCLIVGFIVLLILK* |
Ga0068859_1006361472 | 3300005617 | Switchgrass Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVML |
Ga0068864_1020950611 | 3300005618 | Switchgrass Rhizosphere | MADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQ |
Ga0066903_1043811101 | 3300005764 | Tropical Forest Soil | MAEEEPLLVSPPTPEVAVHVRDYERFTKLLKWGALTCLAV |
Ga0081201_1205892 | 3300006061 | Petroleum Sediment | MAHDEEPLLANPPSAEAAYHVRDYERFTKLLKYGAIICFIIGFLVVLIIS* |
Ga0082029_10916661 | 3300006169 | Termite Nest | MAHDEEPLLADPPSAEAAYHVRDYEQFTKLLKYGALTCLVIAFLVVLIIS* |
Ga0082029_17639782 | 3300006169 | Termite Nest | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYSALVCLAVAFLVVLIIS* |
Ga0070712_1003762292 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEEEPLLVSPPTQEVAVHVRDYERFTKLLKWGALTCLIIGFSVLLILKS* |
Ga0075366_101754462 | 3300006195 | Populus Endosphere | MAEEEPLLVSPPSQDVAVHVRDYVRFTKLLKWGALICLVIGFAVLLILK* |
Ga0079222_121220801 | 3300006755 | Agricultural Soil | MMHEEEPLLASPPTQDMAVHVHDYMRFTKILKWGALFCLLVGFIVLLILK* |
Ga0066665_111472202 | 3300006796 | Soil | MAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWSFLTCLVIAFIVLLILKNG* |
Ga0066659_117016821 | 3300006797 | Soil | MAEEEPLLASPPTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFVVLLI |
Ga0079220_120004021 | 3300006806 | Agricultural Soil | MPDLLDQEEEPLLVSPPTQEAAIHVKDYLRFTQLMKWGALTCLVIGFIVLLILK* |
Ga0075424_1005708022 | 3300006904 | Populus Rhizosphere | MAHEEEPLLVSPPTQEASVHVKDYLHFTKMMKWGALTCLVLGLISLIIVKAYW* |
Ga0079219_124916702 | 3300006954 | Agricultural Soil | MAEEEPLLVSPPTQDMAVHVHDYARFTRLMTRGAIACLIIGFIVLLILK* |
Ga0066709_1014865422 | 3300009137 | Grasslands Soil | MAEEEPILVSPPTQEMAHHVADYARFTRMLKWAALTCLIIGFVVLL |
Ga0105248_124602271 | 3300009177 | Switchgrass Rhizosphere | GIFMAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYGAIACLAIGFLVVLIIS* |
Ga0126310_115050432 | 3300010044 | Serpentine Soil | MAEEEESLLASPPTHEVATHVRDYEAFTRLFKYGAIICLIIGFIVLLILK* |
Ga0126379_113880362 | 3300010366 | Tropical Forest Soil | MAEEEPLLVSPPTQEVAVHVRDYERFTKLLKWGALTCLVIGFTVLLILKS* |
Ga0134126_118221022 | 3300010396 | Terrestrial Soil | MMAEEEPLLVSPPTQEVAAHVHDYERFTKLMKYGALICLVIGIVSLFII |
Ga0137363_107135152 | 3300012202 | Vadose Zone Soil | MAEEEEPILAHPGTHEVAVHVRDYERFTQMMKYGALICLIIGFIVLLILK* |
Ga0137378_113866131 | 3300012210 | Vadose Zone Soil | MDTADRASKESFMAEEERLLVSPSTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFVVLLILKNG* |
Ga0137367_109055122 | 3300012353 | Vadose Zone Soil | MDTADRASKESFMAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWSFLTCLVIAFIVLLILKNG* |
Ga0137385_111325481 | 3300012359 | Vadose Zone Soil | MDTADRASKESLMAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG* |
Ga0157374_123755372 | 3300013296 | Miscanthus Rhizosphere | RDCQMAEEEPLLVSPPSQDVAVHVRDYVRFTKLLKWGALICLVIGFAVLLILK* |
Ga0157374_126700102 | 3300013296 | Miscanthus Rhizosphere | MVHYEEPLFADPPAAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS* |
Ga0157378_123331492 | 3300013297 | Miscanthus Rhizosphere | AHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS* |
Ga0163162_107881732 | 3300013306 | Switchgrass Rhizosphere | MADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFLVLQIL* |
Ga0182000_101104042 | 3300014487 | Soil | MAEEEPILVSPPTQEVAVHVRDYERFTRLLKYGAIACLIIGFIVLLILK* |
Ga0132258_1002290416 | 3300015371 | Arabidopsis Rhizosphere | MAHDEEPLLADPPTAEAAYHVQDYERFTKLLKYGALICLAIAFLVVMIIS* |
Ga0132255_1017604442 | 3300015374 | Arabidopsis Rhizosphere | MAHDEEPLLADPPKAEAAYHVQDYERFTKLLKYGALICLAIAFLVVMIIS* |
Ga0187785_106445221 | 3300017947 | Tropical Peatland | MAEEESILVSPPTQDMANHVHDYTNFTRLLKYGAFICLIIGFIVLLILKK |
Ga0066667_111350022 | 3300018433 | Grasslands Soil | MAEEEPLLVSPPTQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG |
Ga0066662_100537741 | 3300018468 | Grasslands Soil | MAEEEPLLVSPPTQDAAAHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG |
Ga0066662_103047211 | 3300018468 | Grasslands Soil | MAEEEPILVSPPTQEMAHHVADYARFTRMLKYGAFVCLIVGFIVLLILK |
Ga0066662_128569772 | 3300018468 | Grasslands Soil | MAEEEPLLVSPPNQDTAVHVRDYLRFTKLLKWGFLTCLVIAFIVLLILKNG |
Ga0207697_100227141 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYGAIACLAIGFLVVLIIS |
Ga0207697_100773602 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MAHDEEPLLADPPSAEAAYHVQDYERFTKLLKYGALICLAIAFLVVMIIS |
Ga0207656_102330291 | 3300025321 | Corn Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAF |
Ga0207656_104034861 | 3300025321 | Corn Rhizosphere | MAHDEEPLLADPGTQEMTVHVRDYDRFTKLMFRGAILCL |
Ga0207654_106896412 | 3300025911 | Corn Rhizosphere | MADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQIL |
Ga0207657_101612213 | 3300025919 | Corn Rhizosphere | MAHEEEPLLAHPPTQEVAVHVRDYERFTKLFKYGALTCLVIGFVVLLILK |
Ga0207694_102503072 | 3300025924 | Corn Rhizosphere | METRNRKGRLMADDESLLTNPQTQDVAVHVNDYVRFTKLLKWGAVLCLLTGFIVLLIL |
Ga0207664_108339292 | 3300025929 | Agricultural Soil | MAHEEEPLLASPPTQEMAAHVHDYERFTRMIKYGAIACLIVGFIVLLILK |
Ga0207668_112968702 | 3300025972 | Switchgrass Rhizosphere | MADDESLLANPPTHEVAVHVHDYERFTKIMKWGAL |
Ga0207658_116856551 | 3300025986 | Switchgrass Rhizosphere | EEIHEGKDMADDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQIL |
Ga0207676_102065941 | 3300026095 | Switchgrass Rhizosphere | MAHDEEPLLGDPPSAEAAYHVQDYERFTKLLKYGALICL |
Ga0207674_117390371 | 3300026116 | Corn Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVM |
Ga0207674_118882431 | 3300026116 | Corn Rhizosphere | DDESLLANPPTHEVAVHVHDYERFTKIMKWGALFCLVVGFVVLQIL |
Ga0207675_1015848262 | 3300026118 | Switchgrass Rhizosphere | PLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS |
Ga0207675_1027251072 | 3300026118 | Switchgrass Rhizosphere | MAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYGAIACLAIG |
Ga0207698_103009552 | 3300026142 | Corn Rhizosphere | MAEEESLLVSPPTHDVAAHVRDYERFTKLMFRGAVICLIVGLVSLMFIKAYW |
Ga0209461_100379551 | 3300027750 | Agave | RHLKGIKMAHDEEPLLAHPPTAEVAHHVQDYERFTKLLKYGALICLAIAFLVVLIIS |
Ga0209461_100923482 | 3300027750 | Agave | MAHDEEPLLANPPTHEVAVHVRDYERFTRLFKYGALTCLVIGFFVLLIL |
Ga0209168_100971332 | 3300027986 | Surface Soil | MAEEEEPLLASPPTQEVAVHVADYERFTRMLKLGAITCLIIGFIVLLILK |
Ga0247827_100774282 | 3300028889 | Soil | MAHDEEPLLADPPSAEAAYHVRDYEQFTKLLKYGAIVCLIIAFIVVMLIS |
Ga0268240_101502911 | 3300030496 | Soil | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAITCLIIAFIVVMLIS |
Ga0307408_1000342952 | 3300031548 | Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYSALVCLAIAFLVVLIIS |
Ga0307408_1012729632 | 3300031548 | Rhizosphere | MAEEEEPLLAHPPTHEVATHVRDYERFTKLLKWGAL |
Ga0307408_1015743392 | 3300031548 | Rhizosphere | MAEEEEPLLAHPGSPEVATHVRDYERFTRLLKIGALTCLVIAFIV |
Ga0307405_100431152 | 3300031731 | Rhizosphere | MAEEEEPLLAHPGSPEVATHVRDYERFTRLLKIGALTCLVIAFIVLLIL |
Ga0307405_119780541 | 3300031731 | Rhizosphere | DRNKGIGMAEEEEPLLAHPPTHEVATHVRDYERFTKLLKWGALTCLVIAFIVLLIL |
Ga0307413_113927871 | 3300031824 | Rhizosphere | KRVWRNHMAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYSALVCLAIAFLVVLIIS |
Ga0307410_114828951 | 3300031852 | Rhizosphere | YGTPTHRQLKGIKMAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYSALVCLAIAFLVVLIIS |
Ga0310892_112614701 | 3300031858 | Soil | LGAGRSPCYGPGKQIWRKHMAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIACLCIAFIVVMLIS |
Ga0308175_1019605972 | 3300031938 | Soil | MAHEEEPLLASPPTQEVATHVRDYEKFTRMMKWGALTCLIIGFIVLLILK |
Ga0308174_104065382 | 3300031939 | Soil | MAHEEEPLLASPPTQEMAVHVRDYARFTRLLKIGAFTCLIIGFIVLLILK |
Ga0307409_1002629481 | 3300031995 | Rhizosphere | EPLLADPPSAEAAYHVRDYERFTKLLKYSALVCLAIAFLVVLIIS |
Ga0307409_1015537761 | 3300031995 | Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYSALVCLAIAFLVVL |
Ga0307409_1015544852 | 3300031995 | Rhizosphere | MAHDEEPLLAHPPTAEVAHHVEDYERFTKLLKYSALVCLAIAFLVVLIIS |
Ga0307411_100240661 | 3300032005 | Rhizosphere | MAHDEEPLLADPPSAEAGYHVRDYERFTTLLKYSAIAC |
Ga0307411_100316701 | 3300032005 | Rhizosphere | WRNRMAHDEEPLLADPPSAEAGYHVRDYERFTTLLKYSAIACLVIAFLVVLIIS |
Ga0307411_104727971 | 3300032005 | Rhizosphere | MAHDEEPLLADPPSAEAAYHVRDYERFTKLLKYGAIVCLVIAFIVVMLIS |
Ga0307415_1000703173 | 3300032126 | Rhizosphere | DQGSEMAEEEEPLLAHPPTHEAAAHVRDYERFTKLIKWGALAALVVAFGVLMIL |
Ga0310810_113692191 | 3300033412 | Soil | MADDEESLLASPPTQEAAFHVQDYLRFTQIMKWGALTCLVIGFVVLLILR |
⦗Top⦘ |