Scaffold Ga0079491_102092

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0079491_102092

Scaffold Ga0079491_102092

Overview

Basic Information
Taxon OID	3300005795 Open in IMG/M
Scaffold ID	Ga0079491_102092 Open in IMG/M
Source Dataset Name	Subglacial sediment microbial community from Lake Whillans, Antarctica - at 4-6 cm depth
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4949
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Source Dataset Sampling Location
Location Name	West Antarctica
Coordinates	Lat. (^o)	-84.24	Long. (^o)	-153.694	Alt. (m)		Depth (m)	.04 to .06
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087395	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0079491_1020923	F087395	GGAG	VNPELHLPIFLSAFVALQGLFTLWSYRTSGSAPTALLVGLLPLVGLPYQLWQLRARLFDNHIAGMITYLALITACFGFYFLMPADETPWMLIHTMAIFAFLGTANVIGTSLKE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.