3300005795: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 4-6 cm depth

Overview

Basic Information

• IMG/M Taxon OID: 3300005795
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0112339 | Gp0119884 | Ga0079491
• Sample Name: Subglacial sediment microbial community from Lake Whillans, Antarctica - at 4-6 cm depth
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 45162646
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → subglacial lake → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline)

Location Information

• Location: West Antarctica
• Coordinates
  • Lat. (^o): -84.24
  • Long. (^o): -153.694
  • Alt. (m): N/A
  • Depth (m): .04 to .06

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087395	Metagenome	110	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0079491_102092	All Organisms → cellular organisms → Bacteria → Proteobacteria	4949

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0079491_102092	Ga0079491_1020923	F087395	VNPELHLPIFLSAFVALQGLFTLWSYRTSGSAPTALLVGLLPLVGLPYQLWQLRARLFDNHIAGMITYLALITACFGFYFLMPADETPWMLIHTMAIFAFLGTANVIGTSLKE*