| Basic Information | |
|---|---|
| Taxon OID | 3300005794 Open in IMG/M |
| Scaffold ID | Ga0079490_100087 Open in IMG/M |
| Source Dataset Name | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | The Marine Biological Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4282 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | West Antarctica | |||||||
| Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025775 | Metagenome | 200 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0079490_1000873 | F025775 | AGGAG | MKQFMSFQNFPMVVVTLMIIWAWISILSVLIASFF* |
| ⦗Top⦘ |