Basic Information | |
---|---|
Taxon OID | 3300005753 Open in IMG/M |
Scaffold ID | Ga0077776_1028620 Open in IMG/M |
Source Dataset Name | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1459 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent → Microbial Community Analysis Of Hydrothermal Vent Diffuse Flow Samples From Mid-Cayman Rise, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mid-Cayman Rise | |||||||
Coordinates | Lat. (o) | 18.375 | Long. (o) | -81.797 | Alt. (m) | Depth (m) | 2370 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F105335 | Metagenome / Metatranscriptome | 100 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0077776_10286202 | F105335 | N/A | PDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP* |
⦗Top⦘ |