NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105335

Metagenome / Metatranscriptome Family F105335

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105335
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 95 residues
Representative Sequence GVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP
Number of Associated Samples 88
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 97.00 %
% of genes from short scaffolds (< 2000 bps) 84.00 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(37.000 % of family members)
Environment Ontology (ENVO) Unclassified
(77.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(66.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.99%    Coil/Unstructured: 79.01%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF13360PQQ_2 43.00
PF13570PQQ_3 11.00
PF00293NUDIX 6.00
PF00398RrnaAD 1.00
PF00805Pentapeptide 1.00
PF00202Aminotran_3 1.00
PF00400WD40 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 1.00
COG1357Uncharacterized conserved protein YjbI, contains pentapeptide repeatsFunction unknown [S] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms71.00 %
UnclassifiedrootN/A29.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573026|GS311G0146KB_1111270270289All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300002913|JGI26060J43896_10028867Not Available1695Open in IMG/M
3300003540|FS896DNA_10029573All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300003602|JGI26262J51727_1073948All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia700Open in IMG/M
3300003619|JGI26380J51729_10090794All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia694Open in IMG/M
3300004110|Ga0008648_10083245All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia897Open in IMG/M
3300005402|Ga0066855_10232993Not Available601Open in IMG/M
3300005429|Ga0066846_10302753All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia519Open in IMG/M
3300005431|Ga0066854_10313596Not Available530Open in IMG/M
3300005753|Ga0077776_1028620All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1459Open in IMG/M
3300005793|Ga0079404_137017All Organisms → cellular organisms → Bacteria2525Open in IMG/M
3300005951|Ga0066379_10245102Not Available581Open in IMG/M
3300005969|Ga0066369_10008856All Organisms → cellular organisms → Bacteria3929Open in IMG/M
3300006077|Ga0081594_1146571All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1000Open in IMG/M
3300006078|Ga0081595_1018161All Organisms → cellular organisms → Bacteria2359Open in IMG/M
3300006083|Ga0081762_1238986Not Available519Open in IMG/M
3300006323|Ga0068497_1049049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium915Open in IMG/M
3300006335|Ga0068480_1186798Not Available1594Open in IMG/M
3300006340|Ga0068503_10233993All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia780Open in IMG/M
3300006414|Ga0099957_1094771Not Available1733Open in IMG/M
3300006900|Ga0066376_10068368All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2246Open in IMG/M
3300006900|Ga0066376_10238025All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1080Open in IMG/M
3300006900|Ga0066376_10390588All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia798Open in IMG/M
3300006902|Ga0066372_10052757All Organisms → cellular organisms → Bacteria1986Open in IMG/M
3300006902|Ga0066372_10121045All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1372Open in IMG/M
3300007514|Ga0105020_1050806All Organisms → cellular organisms → Bacteria3532Open in IMG/M
3300007515|Ga0105021_1252482All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia904Open in IMG/M
3300008224|Ga0105350_10078787Not Available1382Open in IMG/M
3300009103|Ga0117901_1337180Not Available577Open in IMG/M
3300009104|Ga0117902_1699802All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia750Open in IMG/M
3300009130|Ga0118729_1088080All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1551Open in IMG/M
3300009130|Ga0118729_1108572Not Available1331Open in IMG/M
3300009173|Ga0114996_11040505All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia579Open in IMG/M
3300009339|Ga0117928_1013872All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4573Open in IMG/M
3300009409|Ga0114993_11325618Not Available504Open in IMG/M
3300009786|Ga0114999_11196422All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia542Open in IMG/M
3300010883|Ga0133547_12091360All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1033Open in IMG/M
3300013110|Ga0171652_1048609All Organisms → cellular organisms → Bacteria1119Open in IMG/M
3300013115|Ga0171651_1028778All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1828Open in IMG/M
3300020263|Ga0211679_1017951Not Available1491Open in IMG/M
3300020373|Ga0211660_10222196Not Available645Open in IMG/M
3300020383|Ga0211646_10033542All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales2006Open in IMG/M
3300020390|Ga0211555_10366672Not Available536Open in IMG/M
3300020399|Ga0211623_10035514Not Available1692Open in IMG/M
3300020415|Ga0211553_10261208All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia702Open in IMG/M
3300020426|Ga0211536_10184134All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium814Open in IMG/M
3300020473|Ga0211625_10090882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1759Open in IMG/M
3300021065|Ga0206686_1090347All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia915Open in IMG/M
3300021084|Ga0206678_10184428All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1042Open in IMG/M
3300021087|Ga0206683_10078733Not Available1823Open in IMG/M
3300021087|Ga0206683_10485763All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300021089|Ga0206679_10091298Not Available1780Open in IMG/M
3300021442|Ga0206685_10013122All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2591Open in IMG/M
3300021973|Ga0232635_1032705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales1159Open in IMG/M
3300021978|Ga0232646_1126433All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia861Open in IMG/M
(restricted) 3300024302|Ga0233449_1078470All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1191Open in IMG/M
(restricted) 3300024339|Ga0233445_1223770Not Available545Open in IMG/M
3300025662|Ga0209664_1092573All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300025663|Ga0209775_1063951All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1105Open in IMG/M
3300025667|Ga0209043_1026865All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1953Open in IMG/M
3300025776|Ga0208699_1028026All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia692Open in IMG/M
3300026079|Ga0208748_1016434All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2269Open in IMG/M
3300026086|Ga0207964_1088120Not Available714Open in IMG/M
3300026091|Ga0207962_1002049All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula6767Open in IMG/M
3300026253|Ga0208879_1018067Not Available4167Open in IMG/M
3300026256|Ga0208639_1158313All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia519Open in IMG/M
3300026264|Ga0207991_1016488All Organisms → cellular organisms → Bacteria2659Open in IMG/M
3300027630|Ga0209432_1095164All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium869Open in IMG/M
3300027630|Ga0209432_1096700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia862Open in IMG/M
3300027677|Ga0209019_1039074Not Available1558Open in IMG/M
3300027677|Ga0209019_1094595All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia856Open in IMG/M
3300027685|Ga0209554_1036770Not Available1893Open in IMG/M
3300027827|Ga0209035_10541899Not Available560Open in IMG/M
3300028489|Ga0257112_10030637Not Available2015Open in IMG/M
3300028489|Ga0257112_10117603All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia959Open in IMG/M
3300028535|Ga0257111_1245242Not Available521Open in IMG/M
3300031571|Ga0308141_1039381All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia858Open in IMG/M
3300031605|Ga0302132_10347429All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia678Open in IMG/M
3300031606|Ga0302119_10023456All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2624Open in IMG/M
3300031606|Ga0302119_10032943All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2189Open in IMG/M
3300031612|Ga0308009_10096180All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1126Open in IMG/M
3300031623|Ga0302123_10484142Not Available555Open in IMG/M
3300031627|Ga0302118_10104465All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1410Open in IMG/M
3300031627|Ga0302118_10129211All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1245Open in IMG/M
3300031639|Ga0302117_10062547All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1731Open in IMG/M
3300031647|Ga0308012_10411801Not Available527Open in IMG/M
3300031688|Ga0308011_10219281All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia572Open in IMG/M
3300031693|Ga0302139_10203468All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia849Open in IMG/M
3300031766|Ga0315322_10226779All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1300Open in IMG/M
3300031803|Ga0310120_10191647All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1123Open in IMG/M
3300031886|Ga0315318_10121461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1460Open in IMG/M
3300031886|Ga0315318_10152974Not Available1303Open in IMG/M
3300032019|Ga0315324_10241348All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia666Open in IMG/M
3300032047|Ga0315330_10506985All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia728Open in IMG/M
3300032151|Ga0302127_10238822All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia777Open in IMG/M
3300032278|Ga0310345_10736445All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia956Open in IMG/M
3300032278|Ga0310345_11082240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia784Open in IMG/M
3300032360|Ga0315334_10013392All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula5415Open in IMG/M
3300032820|Ga0310342_101774821All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia736Open in IMG/M
3300034695|Ga0372840_266213Not Available505Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine37.00%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater12.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine9.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine8.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine6.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine2.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine2.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.00%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent2.00%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.00%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine1.00%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm1.00%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids1.00%
Deep-Sea Hydrothermal VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent1.00%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent1.00%
Diffuse Hydrothermal FluidEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid1.00%
Diffuse Hydrothermal FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluids1.00%
Hydrothermal Vent FluidsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Fluids1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573026Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-FOS-0p8-Deep1200EnvironmentalOpen in IMG/M
3300002913Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300003540Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS896_ElGuapo_DNAEnvironmentalOpen in IMG/M
3300003602Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_150m_DNAEnvironmentalOpen in IMG/M
3300003619Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_165m_DNAEnvironmentalOpen in IMG/M
3300004110Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNAEnvironmentalOpen in IMG/M
3300005402Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73EnvironmentalOpen in IMG/M
3300005429Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76EnvironmentalOpen in IMG/M
3300005431Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV75EnvironmentalOpen in IMG/M
3300005753Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assemblyEnvironmentalOpen in IMG/M
3300005793Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean. Combined Assembly of Gp0107627, Gp0107629, Gp0119879, Gp0119880, Gp0119881, Gp0107619EnvironmentalOpen in IMG/M
3300005951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300005969Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_AEnvironmentalOpen in IMG/M
3300006077Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid BEnvironmentalOpen in IMG/M
3300006078Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid CEnvironmentalOpen in IMG/M
3300006083Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS908_Marker33_DNAEnvironmentalOpen in IMG/M
3300006323Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT237_3_0500mEnvironmentalOpen in IMG/M
3300006335Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_2_0500mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006414Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500mEnvironmentalOpen in IMG/M
3300006900Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_AEnvironmentalOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007515Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300008224Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1E Hudson CanyonEnvironmentalOpen in IMG/M
3300009103Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7umEnvironmentalOpen in IMG/M
3300009104Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2umEnvironmentalOpen in IMG/M
3300009130Combined Assembly of Gp0139511, Gp0139512EnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009339Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300013110Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300013115Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300020263Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125)EnvironmentalOpen in IMG/M
3300020373Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946)EnvironmentalOpen in IMG/M
3300020383Marine microbial communities from Tara Oceans - TARA_B100000929 (ERX556043-ERR598971)EnvironmentalOpen in IMG/M
3300020390Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985)EnvironmentalOpen in IMG/M
3300020399Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947)EnvironmentalOpen in IMG/M
3300020415Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166)EnvironmentalOpen in IMG/M
3300020426Marine microbial communities from Tara Oceans - TARA_B100000378 (ERX555992-ERR599112)EnvironmentalOpen in IMG/M
3300020473Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)EnvironmentalOpen in IMG/M
3300021065Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021973Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Alice_FS923 _150kmerEnvironmentalOpen in IMG/M
3300021978Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Perseverance_CTD_V16A_01_btl17 _150kmerEnvironmentalOpen in IMG/M
3300024302 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MGEnvironmentalOpen in IMG/M
3300024339 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_100_MGEnvironmentalOpen in IMG/M
3300025662Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI073_LV_150m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025663Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_135m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025667Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025776Marine microbial communities from the Deep Pacific Ocean - MP2097 (SPAdes)EnvironmentalOpen in IMG/M
3300026079Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026086Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026091Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026253Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026256Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 (SPAdes)EnvironmentalOpen in IMG/M
3300026264Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 (SPAdes)EnvironmentalOpen in IMG/M
3300027630Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_800m (SPAdes)EnvironmentalOpen in IMG/M
3300027677Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_300m (SPAdes)EnvironmentalOpen in IMG/M
3300027685Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300028489Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000mEnvironmentalOpen in IMG/M
3300028535Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500mEnvironmentalOpen in IMG/M
3300031571Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_535_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031606Marine microbial communities from Western Arctic Ocean, Canada - AG5_TmaxEnvironmentalOpen in IMG/M
3300031612Marine microbial communities from water near the shore, Antarctic Ocean - #127EnvironmentalOpen in IMG/M
3300031623Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1EnvironmentalOpen in IMG/M
3300031627Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1EnvironmentalOpen in IMG/M
3300031639Marine microbial communities from Western Arctic Ocean, Canada - AG5_32.2EnvironmentalOpen in IMG/M
3300031647Marine microbial communities from water near the shore, Antarctic Ocean - #179EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031693Marine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031803Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983EnvironmentalOpen in IMG/M
3300031886Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 3416EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032151Marine microbial communities from Western Arctic Ocean, Canada - CB4_SCMEnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034695Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GS311G0146KB_003668702189573026Marine EstuarineLKPGAKPIVLSDHSAGVESLAFAPDSSQFASGSRNGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWDNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK*QFILQGTRVHVWLSTLLF
JGI26060J43896_1002886723300002913MarineDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK*
FS896DNA_1002957313300003540Diffuse Hydrothermal Flow Volcanic VentSAGVESLAFAPDSGQLASGSRNGRVRLHSIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP
JGI26262J51727_107394823300003602MarineFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK*
JGI26380J51729_1009079413300003619MarineTGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK*
Ga0008648_1008324523300004110MarineEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK*
Ga0066855_1023299313300005402MarineQAPRVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK*
Ga0066846_1030275313300005429MarineGVGEPPDATGFGQAPRVLCLDWNRAGLIGGTSTGYIFGLPTGQGDWQPLHREKASPVYSLGQAPAQIVGGKTGQLLKLAEPAK*
Ga0066854_1031359623300005431MarineRVRLHSTEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWNRAGLIGGTSTGYIFGLPTGQGDWQPLHREKASPVYSLGQAPAQIVGGKTGQLLKLAEPAK*
Ga0077776_102862023300005753Deep-Sea Hydrothermal VentPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP*
Ga0079404_13701713300005793Diffuse Hydrothermal Flow Volcanic VentADHSAGVESLAFAPDSGQLASGSRDGRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP*
Ga0066379_1024510213300005951MarineGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDPAGPVYSVGQAPDQIVAGKTAQVFQLAEPAK*
Ga0066369_1000885653300005969MarineATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP*
Ga0081594_114657123300006077Diffuse Hydrothermal FluidVESLAFAPNSSQLATGSRDGRVRLHSIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGEAPGQIVAGKTGQLLKLPKP*
Ga0081595_101816133300006078Diffuse Hydrothermal FluidsVLSDHSAGVESLAFAPNSGQLASGSRDGRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP*
Ga0081762_123898623300006083Diffuse Hydrothermal Flow Volcanic VentPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGEAPGQIVAGKTGQLLKLPKP*
Ga0068497_104904913300006323MarineFASGSRNGRVRLHSIGGRLLRTYQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK*
Ga0068480_118679823300006335MarineGEPPNATGFGQAPRVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK*
Ga0068503_1023399323300006340MarineDATGFGQAPRVLCLAWDNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK*
Ga0099957_109477113300006414MarineSLAFAPDSSQFASGSRNGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQSPGQIVAGKTAQVFQLAEPAK*
Ga0066376_1006836813300006900MarineEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAHGQIVAGKTGQVFQLAEPAK*
Ga0066376_1023802513300006900MarineIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSSGYVFRLPNGQGDWQPLHRKTAGPVYSLGQTPEQIIAGKTGQLLRLTKPSK*
Ga0066376_1039058813300006900MarineEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP*
Ga0066372_1005275713300006902MarineTGFGQEPRVLCLAWDNTALIGGTSTGYVFGLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK*
Ga0066372_1012104513300006902MarinePRVLCLDWSEAGLIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQSPGQIVAGKTGQVLKLAESAK*
Ga0105020_105080653300007514MarineVGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTKAGPVYSLGQGPGQIVAGTTGQLLKLPRPTK*
Ga0105021_125248213300007515MarineVGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGLWQPLHRTKAGPVYSLGQGPGQIVAGTTGQLLKLPRPTK*
Ga0105350_1007878713300008224Methane Seep MesocosmLAFAPDSSQFASGSRDSRVRLHSIGGRLLRTFQGVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK*
Ga0117901_133718013300009103MarineGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGLWQPLHRTKAGPVYSLGQGPGQIVAGTTGQLLKLPRPTK*
Ga0117902_169980213300009104MarineGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTKAGPVYSLGQGPGQMVAGKSGQLLKLAEPAK*
Ga0118729_108808023300009130MarineGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTKAGPVYSLGQAPGQIVAGKSGQLLKLAEPAK*
Ga0118729_110857213300009130MarineGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQAPDQIVAGKTAQVFQLAEPAK*
Ga0114996_1104050523300009173MarineGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP*
Ga0117928_101387213300009339MarineVLADHSAGVESLAFAPNSGRLATGSRDGRVRLHSIEGRLLRTFAGVGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTKAGPVYSLGQAPGQIVAGKSGQLLKLAEPAK*
Ga0114993_1132561813300009409MarineQLATGSRDGRVRLHSIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSRAGLIGGTSSGYIFRLPSGQGDWQPLHRVKASPVYSLGQAPGQIVAGKTSQLLKLAEP*
Ga0114999_1119642223300009786MarineLRTFQGVGEPPDATGFGQAPRVLCLDWSRAGLIGGTSSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVAGKNGQVLKLPKPKK*
Ga0133547_1209136013300010883MarineRTFQGLGEPPDATGFGQTPRVLCLDWSRAGLIGGTSSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVAGKNGQVLKLPKPTK*
Ga0171652_104860923300013110MarineGLVLLTPRQPGVKPVVLADHSAGIESLAFAPNSGRLATGSRDGRVRLHSIEGRLLRTFAGVGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGLWQPLHRTKAGPVYSLGQGPGQIVAGTTGQLLKLPRPTK*
Ga0171651_102877813300013115MarineVGEPPDATGFGSAPRVLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTKAGPVYSLGQGPGQMVAGKSGQLLKLAEPAK*
Ga0211679_101795123300020263MarineHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHRDQAGPVYSVGQAHGQIVAGKTGQVFQLAEPAK
Ga0211660_1022219613300020373MarineSARLASGSRDGRVRLHSSEGRLLRTFQGVGEPPDATGFGQTPRVLCLNWSGAGLIGGTSSGYVFRLPSGQGEWQPLHCEKASPVYSLGQTPAEIVSGKTGQLLKLPKS
Ga0211646_1003354213300020383MarineGEPPDATGFGQEPRVLCLAWGNTALIGGTSTGYVFGLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0211555_1036667213300020390MarinePPDATGFGQAPRVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPDQIVAGKTAQVFQLAEPAK
Ga0211623_1003551413300020399MarineATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK
Ga0211553_1026120813300020415MarineHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK
Ga0211536_1018413413300020426MarineTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQSPGQIVAGKTAQVFQLAEPAK
Ga0211625_1009088223300020473MarineVRLHSIEGRLLRTFAGVGEPPAATGFGSAPRMLCLDWNEDRLIGGTSTGFLFRLPDGQGRWQPLHRTTAGPVYSLGQAPGQMVAGKSGQIFKLAEPAK
Ga0206686_109034713300021065SeawaterSRDGRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQAPGQIVAGKTGQLLKLPKP
Ga0206678_1018442813300021084SeawaterFQGVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0206683_1007873313300021087SeawaterSNQFASGSRDGRVRLHSIGGRLLRTFQGVGEPPNATGFGQAPRVLCLAWSNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK
Ga0206683_1048576323300021087SeawaterSNQFASGSRDGRVRLHSIGGRLLRTFQGVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0206679_1009129833300021089SeawaterDGRVRLHSIGGRLLRTFQGVGEPPDATGFGQEPRVLCLAWGNTALIGGTSTGYVFGLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0206685_1001312233300021442SeawaterFQGVGEPPNATGFGQAPRVLCLAWSNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK
Ga0232635_103270523300021973Hydrothermal Vent FluidsSGSRDGRVRLHSIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSSGYVFRLPSGQGDWQPLHRVKTGPVYSLGQTPGQIVAGKTGQVFKLAESAE
Ga0232646_112643323300021978Hydrothermal Vent FluidsSRDSRVRLHSIGGRLLRTFQGVGESPDATGFGQAPRVLCLDWSEAGLIGGTSSGYVFRLPNGQGDWQPLHRKTAGPVYSLGQTPEQIIAGKTGQLLRLTKPSK
(restricted) Ga0233449_107847023300024302SeawaterKAKPIVLADHSAGVESLAFAPDSSQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
(restricted) Ga0233445_122377023300024339SeawaterQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPKATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0209664_109257323300025662MarineRKPKAKPIVLADHSAGVESLAFAPDSRQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0209775_106395123300025663MarineRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0209043_102686513300025667MarineDHSAGVESLAFAPDSSQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0208699_102802613300025776Deep OceanSLAFAPDSARLASGSRDGRVRLHSTEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWNRAGLIGGTSTGYIFGLPTGQGDWQPLHREKASPVYSLGQAPAQIVGGKTGQLLKLAEPAK
Ga0208748_101643433300026079MarineGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP
Ga0207964_108812013300026086MarineQLASGSRDGRVRLHSIGGRLLRTFQGVGEPPNATGFGQAPRVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK
Ga0207962_100204973300026091MarineRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQAPGQIVAGKTGQLLKLPKP
Ga0208879_101806713300026253MarineGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAHGQIVAGKTGQVFQLAEPAK
Ga0208639_115831313300026256MarineGVGEPPDATGFGQAPRVLCLDWNRAGLIGGTSTGYIFGLPTGQGDWQPLHREKASPVYSLGQAPAQIVGGKTGQLLKLAEPAK
Ga0207991_101648843300026264MarineGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQAPGQIVAGKTAQLLKLPKP
Ga0209432_109516423300027630MarineRNGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQSPGQIVAGKTAQVFQLAEPAK
Ga0209432_109670023300027630MarineDGRVRLHSIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSRANLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYSLGQAPDEIVAGKTGQLLKLAEPAK
Ga0209019_103907423300027677MarineSQFASGSRDGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYIFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK
Ga0209019_109459523300027677MarineRTFQRVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYVFGLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK
Ga0209554_103677033300027685MarineGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAHGQIVAGKTGQVFQLAEPAK
Ga0209035_1054189913300027827MarineMAKLRLGDDLVYSVSVSPDAAGFGQAARVLCLDWSETGLFGGTSSGYIFRLPSGQGDWQPLHRVKASPVYSLGQAPGQIVAGKTSQLLKLAEP
Ga0257112_1003063733300028489MarineFAPDSSQFASGSRDGRVRLHSIGGRLLRTFQGVGEPPDATGFGQAPRVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK
Ga0257112_1011760313300028489MarineSLAFAPNSGQLASGSRDGRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP
Ga0257111_124524223300028535MarinePPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP
Ga0308141_103938123300031571MarineRLLRTFQGVGEPPNATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGHAPGQIVAGKTGQLLKLPKP
Ga0302132_1034742923300031605MarineEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYSLAQASGQIVAGKTGQLLKLPKP
Ga0302119_1002345633300031606MarineSQFASGSRDGRVRLHSIGGRLLRTFQGVGEPPNATGFGQAPHVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK
Ga0302119_1003294313300031606MarineQLATGSRDSRVRLHTIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSETGLFGGTSSGYIFRLPSGQGDWQPLHRVKASPVYSLGQAPGQIVAGKTSQLLKLAEP
Ga0308009_1009618013300031612MarineRLHSIEGRLLRTFQGVGEPPDATGFGQTPRVLCLDWSRAGLIGGTSSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVTGKNGQVLKLPKPAK
Ga0302123_1048414223300031623MarineGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYSLAQASGQIVAGKTGQLLKLPKP
Ga0302118_1010446513300031627MarineDHSAGVESLAFAPDSSQLATGSRDSRVRLHSIEGRLLRTFQGLGEPPDATGFGQTPRVLCLDWSRAGLIGGTSSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVAGKNGQVLKLPKPTK
Ga0302118_1012921123300031627MarineDSRVRLHTIEGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSETGLFGGTSSGYIFRLPSGQGDWQPLHRVKASPVYSLGQAPGQIVAGKTSQLLKLAEP
Ga0302117_1006254713300031639MarineGEPPDATGFGQTPRVLCLDWSRAGLIGGTSSGYIFRLPSGQGDWQPLHRVKASPVYSLSQAPGQIVAGKTSQLLKLAEP
Ga0308012_1041180113300031647MarineQLATGSRDSRVRLHSIEGRLLRTFQGVGEPPDATGFGQTPRVLCLDWSRAGLIGGASSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVTGKNGQVLKLPKPAK
Ga0308011_1021928113300031688MarineATGFGQTPRVLCLDWSRAGLIGGTSSGYVFRLPIGQGNWQSLHREKADPVYSLGQTPDEIVAGKNGQVLKLPKPAK
Ga0302139_1020346823300031693MarineRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKTTPVYSLGQASGQIVAGKTGQLLKLPKP
Ga0315322_1022677913300031766SeawaterKPKAKPIVLADHSAGVESLAFAPDSSQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0310120_1019164713300031803MarineESLAFAPDSGQLASGSRDGRVRLHTIGGRLLRTFQGVGEPPDATGFGQAPRVLCLDWSEAGLIGGTSTGYVFRLPNGQGDWQPLHREKASPVYALGQAPGQIVAGKTGQLLKLPKP
Ga0315318_1012146123300031886SeawaterPRVLCLAWGNTALIGGTSTGYVFGLPSGQGNWQPLHLDQAGPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0315318_1015297423300031886SeawaterQGVGEPPNATGFGQAPRVLCLAWSNTALIGGTSTGYVFRLPSGQGNWQPLHRDQAGPVYSVGQAPGQIVAGKTAQVFQLAEPAK
Ga0315324_1024134813300032019SeawaterRNGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWDNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK
Ga0315330_1050698523300032047SeawaterPDSSQLATGSRDSRVRLHTIGGRLLRTFQGVGEPPNATGFGQAPRVLCLDWSETWLIGGTSTGYVFRLPSGQGNWQPLHREKASPVYALGQSTGQIVAGKPSQLLKLPKPAK
Ga0302127_1023882213300032151MarineRVLCLDWSEAGLIGGTSTGYVFRLPSGQGDWQPLHREKASPVYALGQASGQIVAGKTGQLLKLPKP
Ga0310345_1073644523300032278SeawaterSRNGRVRLHSIGGRLLRTFQRVGEPPDATGFGQAPRVLCLAWDNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK
Ga0310345_1108224013300032278SeawaterGVESLAFAPDSGQLASGSRDGRVRLHATGGRLLRTFQGIGEPPDATGFDQAPRVLCLDWSRADLIGGTSTGYVFRLPNGQGDWQPLHREKANPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0315334_1001339273300032360SeawaterQGIGEPPDATGFDQAPRVLCLDWSRADLIGGTSTGYVFRLPNGQGDWQPLHREKANPVHSLGQTLDQIVTGKTGHVFKLAKPAK
Ga0310342_10177482113300032820SeawaterGQAPRVLCLAWDNTALIGGTSTGYIFRLPSGQGNWQPLHLDQAGPVYSVGQAPGQIVAGKTGQVLKLAESAK
Ga0372840_266213_146_3493300034695SeawaterVLCLAWGNTALIGGTSTGYVFRLPSGQGNWQPLHRNQAGPVYSVGQAPGQIVAGKTGQVFQLAEPAK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.