Scaffold Ga0068834_100137

Overview

Basic Information

• Taxon OID: 3300005630
• Scaffold ID: Ga0068834_100137
• Source Dataset Name: Enriched soil aggregate microbial communities from Iowa State university to study microbial drivers of carbon cycling - Hofmockel_1000072-3 ISU MetaT (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 747
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Enriched Soil Aggregate → Enriched Soil Aggregate Microbial Communities From Iowa State University To Study Microbial Drivers Of Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: Iowa
• Coordinates
  • Lat. (^o): 42.0266187
  • Long. (^o): -93.6486594

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060965	Metagenome / Metatranscriptome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068834_1001371	F060965	N/A	GVLMVGDFTPAIRAIRYSSINNVLTLTLLMARLGADDTNHALALDDLAVAANPLD*