Basic Information | |
---|---|
Taxon OID | 3300005407 Open in IMG/M |
Scaffold ID | Ga0074248_1084179 Open in IMG/M |
Source Dataset Name | Mixed alcohol bioreactor microbial communities from Texas A and M University - 55C, Day 16 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 639 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Mixed Alcohol Bioreactor → Mixed Alcohol Bioreactor Microbial Communities From Texas A&M University |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Texas A and M University College Station, Texas, USA | |||||||
Coordinates | Lat. (o) | 30.620833 | Long. (o) | -96.341111 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F091897 | Metagenome / Metatranscriptome | 107 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0074248_10841792 | F091897 | AGGAG | MIGSSIPTFLNIQYQCCKCGKDLGDKYSRLKGKKQPDVNIIKGKLYCNKCADKHWND* |
⦗Top⦘ |