Scaffold Ga0074272_129010

Overview

Basic Information

• Taxon OID: 3300005380
• Scaffold ID: Ga0074272_129010
• Source Dataset Name: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In Plume
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1558
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.716667
  • Long. (^o): -88.466667
  • Depth (m): 1125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074272_1290101	F077438	N/A	VTSLWCVYSTHRVEPSFRQSRFETPYLCSFQLEISIALRPNVEKETSSYKN*