3300005380: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In Plume

Overview

Basic Information

• IMG/M Taxon OID: 3300005380
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0047147 | Gp0052346 | Ga0074272
• Sample Name: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 16-5 In Plume
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 73128958
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine black smoker biome → black smoker → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Gulf of Mexico
• Coordinates
  • Lat. (^o): 28.716667
  • Long. (^o): -88.466667
  • Alt. (m): N/A
  • Depth (m): 1125

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y
F077781	Metagenome / Metatranscriptome	117	N

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0074272_115297	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Mammalia → Theria → Eutheria → Boreoeutheria → Euarchontoglires → Primates → Haplorrhini → Simiiformes	1167
Ga0074272_129010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia → Escherichia coli	1558

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074272_115297	Ga0074272_1152971	F077781	PIAAPARPAPAHLKAPAAVTGGWGSPRQNDFFILLTLESPAPCDPLQTESHLVFRTRIHSQVQWGDVRGVAGRTKDSLPSDSVCTVGPRAGALSVRTADSLYLGFPRPHPGTPGLGRFWPFLALQSLSETPSHARMPRVTVARTSPETLEISPLRAAT*
Ga0074272_129010	Ga0074272_1290101	F077438	VTSLWCVYSTHRVEPSFRQSRFETPYLCSFQLEISIALRPNVEKETSSYKN*