Scaffold Ga0073581_109247

Overview

Basic Information

• Taxon OID: 3300005264
• Scaffold ID: Ga0073581_109247
• Source Dataset Name: Hydrothermal sediment microbial communities from Guaymas Basin, California, USA 4572. Combined assembly of Gp0115316 and Gp0146562
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Texas, Austin
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 7297
• Total Scaffold Genes: 12
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (41.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Sediment → Hydrothermal Sediment Microbial Communities From Guaymas Basin, California, Usa

Source Dataset Sampling Location

• Location Name: Guaymus Basin
• Coordinates
  • Lat. (^o): 27.013056
  • Long. (^o): -111.519722
  • Depth (m): 0 to .12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036294	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073581_1092479	F036294	AGCAG	MDRGFSDEAIVGVKPAADEDAVTYQRVKLSENDKDVGAEGRNM*