Scaffold Ga0072504_101697

Overview

Basic Information

• Taxon OID: 3300005095
• Scaffold ID: Ga0072504_101697
• Source Dataset Name: Hydrothermal chimney microbial communities from the East Pacific Rise - L vent 8
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Beijing Genomics Institute (BGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 16068
• Total Scaffold Genes: 31
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 17 (54.84%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Source Dataset Sampling Location

• Location Name: East Pacific Rise
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088984	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0072504_10169724	F088984	N/A	MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDSLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*