Scaffold Ga0069612_10123421

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0069612_10123421

Scaffold Ga0069612_10123421

Overview

Basic Information
Taxon OID	3300005076 Open in IMG/M
Scaffold ID	Ga0069612_10123421 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0111534, Gp0111535, Gp0111536
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	839
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Bioreactor → Activated Sludge Wastewater Microbial Communities From Ann Arbor, Michigan, Usa

Source Dataset Sampling Location
Location Name	Ann Arbor, MI
Coordinates	Lat. (^o)	42.293023	Long. (^o)	-83.713393	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069722	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069612_101234211	F069722	GAGG	MRVRLTAELDPKAKRERPALKKGAAQEKALGHGSGAALQEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.